Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3RZL8

Protein Details
Accession A0A0C3RZL8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
72-98GRICCRPGSNLRRRRSRPAGPDCDRSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, extr 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MVCYCESMIILVRARASTKNSSLKAARPTRTSICDGSAPRAPCDAAPHSGASDPRRIECTCRSHHPSAGSEGRICCRPGSNLRRRRSRPAGPDCDRSSGQATIRLGATG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.24
4 0.26
5 0.32
6 0.39
7 0.39
8 0.44
9 0.45
10 0.47
11 0.52
12 0.54
13 0.51
14 0.46
15 0.49
16 0.48
17 0.5
18 0.48
19 0.39
20 0.34
21 0.34
22 0.32
23 0.31
24 0.31
25 0.28
26 0.25
27 0.25
28 0.23
29 0.18
30 0.21
31 0.2
32 0.17
33 0.17
34 0.16
35 0.16
36 0.17
37 0.19
38 0.17
39 0.19
40 0.17
41 0.17
42 0.2
43 0.2
44 0.22
45 0.26
46 0.3
47 0.3
48 0.37
49 0.43
50 0.42
51 0.45
52 0.44
53 0.39
54 0.4
55 0.4
56 0.34
57 0.29
58 0.28
59 0.27
60 0.26
61 0.25
62 0.2
63 0.18
64 0.21
65 0.29
66 0.39
67 0.47
68 0.54
69 0.62
70 0.71
71 0.75
72 0.8
73 0.8
74 0.78
75 0.78
76 0.8
77 0.82
78 0.77
79 0.8
80 0.74
81 0.7
82 0.61
83 0.53
84 0.47
85 0.41
86 0.37
87 0.34
88 0.32
89 0.28