Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NCJ1

Protein Details
Accession A0A0C3NCJ1    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
74-99DDAPPRRARLRRRVRDGRERQRERAHBasic
NLS Segment(s)
PositionSequence
78-107PRRARLRRRVRDGRERQRERAHASQRRARG
Subcellular Location(s) nucl 20, cyto 3, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MSLSPSCLAHDVWTAAFSLLPAQVQDTFDWEKEPDEVSRTTRVTSPSSLGSNFCPASNKKGAQTQGAAIRLTDDDAPPRRARLRRRVRDGRERQRERAHASQRRARGLPLPPTPGSLPCSAGCSTSTPSSRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.1
5 0.09
6 0.08
7 0.08
8 0.08
9 0.09
10 0.11
11 0.12
12 0.12
13 0.15
14 0.17
15 0.17
16 0.18
17 0.17
18 0.16
19 0.16
20 0.17
21 0.14
22 0.15
23 0.16
24 0.18
25 0.22
26 0.22
27 0.22
28 0.23
29 0.25
30 0.25
31 0.24
32 0.24
33 0.21
34 0.22
35 0.22
36 0.2
37 0.18
38 0.19
39 0.18
40 0.16
41 0.18
42 0.17
43 0.22
44 0.26
45 0.26
46 0.24
47 0.29
48 0.3
49 0.28
50 0.28
51 0.24
52 0.23
53 0.23
54 0.21
55 0.16
56 0.15
57 0.13
58 0.13
59 0.11
60 0.08
61 0.11
62 0.15
63 0.19
64 0.18
65 0.21
66 0.27
67 0.33
68 0.41
69 0.47
70 0.55
71 0.61
72 0.71
73 0.79
74 0.8
75 0.85
76 0.88
77 0.88
78 0.88
79 0.84
80 0.81
81 0.79
82 0.76
83 0.72
84 0.71
85 0.71
86 0.68
87 0.7
88 0.7
89 0.68
90 0.68
91 0.62
92 0.54
93 0.5
94 0.49
95 0.5
96 0.48
97 0.48
98 0.42
99 0.45
100 0.44
101 0.4
102 0.37
103 0.3
104 0.28
105 0.22
106 0.26
107 0.23
108 0.22
109 0.2
110 0.2
111 0.23
112 0.27
113 0.29