Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3RZ76

Protein Details
Accession A0A0C3RZ76    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-92IYNKHPVKWLPAKDKSKNKTHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 9, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009542  Spc1/SPCS1  
Gene Ontology GO:0005787  C:signal peptidase complex  
GO:0006465  P:signal peptide processing  
Pfam View protein in Pfam  
PF06645  SPC12  
Amino Acid Sequences MEALQAKVQSLVEGKIDFEGQKKVEVLTRVILVAATIISFIVGLALQSLRATFGIFSVTIIVLSLVIVPPWPIYNKHPVKWLPAKDKSKNKTLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.15
4 0.14
5 0.15
6 0.18
7 0.16
8 0.18
9 0.18
10 0.18
11 0.21
12 0.21
13 0.21
14 0.18
15 0.17
16 0.15
17 0.15
18 0.13
19 0.09
20 0.07
21 0.06
22 0.04
23 0.03
24 0.03
25 0.03
26 0.03
27 0.02
28 0.02
29 0.02
30 0.02
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.05
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.06
58 0.08
59 0.11
60 0.15
61 0.26
62 0.32
63 0.34
64 0.42
65 0.42
66 0.49
67 0.56
68 0.61
69 0.6
70 0.65
71 0.72
72 0.74
73 0.83
74 0.79