Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FMS8

Protein Details
Accession Q6FMS8   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
211-241LTNLKIQLKKTKIKQNKVKKPLNKNKNNVFGHydrophilic
NLS Segment(s)
PositionSequence
219-233KKTKIKQNKVKKPLN
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019447  DNA/RNA-bd_Kin17_WH-like_dom  
IPR037321  KIN17-like  
IPR038254  KIN17_WH-like_sf  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG cgr:CAGL0K05533g  -  
Pfam View protein in Pfam  
PF10357  Kin17_mid  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MSEDFNSAKFLNKQLKARGLQKLRFYCQVCNKQCRDQNGFKSHVKSPSHLKNISTVTQDDILEFTKLFEENFLNTLKTNHGEKKIAVNKLYNEIIKDRDHIHMNATSFKSLTGFIKYLSKEGKIKVYDDNIGDMPEDQVDLTQLNISFIDNSDTNLRRKEKLQEIEAEELTESKLEEYLRTKRQLREQEEEESDVQDTDLGSNTDIQRDNLTNLKIQLKKTKIKQNKVKKPLNKNKNNVFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.61
4 0.66
5 0.68
6 0.68
7 0.68
8 0.71
9 0.71
10 0.67
11 0.69
12 0.64
13 0.63
14 0.64
15 0.69
16 0.67
17 0.69
18 0.7
19 0.71
20 0.74
21 0.73
22 0.71
23 0.7
24 0.71
25 0.69
26 0.7
27 0.65
28 0.65
29 0.62
30 0.62
31 0.55
32 0.48
33 0.5
34 0.53
35 0.57
36 0.54
37 0.5
38 0.48
39 0.49
40 0.49
41 0.43
42 0.33
43 0.28
44 0.28
45 0.27
46 0.21
47 0.18
48 0.16
49 0.13
50 0.13
51 0.1
52 0.09
53 0.09
54 0.09
55 0.1
56 0.1
57 0.1
58 0.12
59 0.13
60 0.12
61 0.12
62 0.13
63 0.14
64 0.15
65 0.19
66 0.22
67 0.26
68 0.27
69 0.27
70 0.36
71 0.41
72 0.42
73 0.39
74 0.37
75 0.34
76 0.37
77 0.39
78 0.29
79 0.24
80 0.22
81 0.23
82 0.2
83 0.21
84 0.19
85 0.19
86 0.22
87 0.2
88 0.21
89 0.21
90 0.21
91 0.24
92 0.23
93 0.2
94 0.17
95 0.17
96 0.15
97 0.13
98 0.13
99 0.11
100 0.1
101 0.1
102 0.15
103 0.15
104 0.17
105 0.17
106 0.19
107 0.18
108 0.19
109 0.25
110 0.21
111 0.22
112 0.22
113 0.23
114 0.24
115 0.21
116 0.22
117 0.16
118 0.15
119 0.14
120 0.11
121 0.09
122 0.07
123 0.06
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.05
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.09
137 0.07
138 0.09
139 0.14
140 0.17
141 0.19
142 0.25
143 0.28
144 0.27
145 0.3
146 0.37
147 0.4
148 0.44
149 0.45
150 0.45
151 0.46
152 0.48
153 0.44
154 0.37
155 0.28
156 0.22
157 0.19
158 0.13
159 0.09
160 0.05
161 0.07
162 0.07
163 0.1
164 0.15
165 0.22
166 0.28
167 0.35
168 0.41
169 0.44
170 0.53
171 0.61
172 0.63
173 0.63
174 0.6
175 0.6
176 0.57
177 0.55
178 0.46
179 0.38
180 0.31
181 0.23
182 0.19
183 0.13
184 0.11
185 0.08
186 0.09
187 0.08
188 0.08
189 0.13
190 0.14
191 0.18
192 0.19
193 0.19
194 0.22
195 0.23
196 0.26
197 0.27
198 0.28
199 0.26
200 0.29
201 0.36
202 0.37
203 0.4
204 0.47
205 0.49
206 0.57
207 0.63
208 0.7
209 0.72
210 0.78
211 0.84
212 0.86
213 0.89
214 0.91
215 0.92
216 0.91
217 0.92
218 0.92
219 0.93
220 0.92
221 0.91