Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FJP0

Protein Details
Accession Q6FJP0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
282-304RDDYLAKLKLNKKKKTQVQNDELHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044569  PDIA6-like  
IPR036249  Thioredoxin-like_sf  
IPR017937  Thioredoxin_CS  
IPR013766  Thioredoxin_domain  
Gene Ontology GO:0003756  F:protein disulfide isomerase activity  
GO:0019153  F:protein-disulfide reductase (glutathione) activity  
GO:0006457  P:protein folding  
KEGG cgr:CAGL0M04741g  -  
Pfam View protein in Pfam  
PF00085  Thioredoxin  
PROSITE View protein in PROSITE  
PS00194  THIOREDOXIN_1  
PS51352  THIOREDOXIN_2  
CDD cd03002  PDI_a_MPD1_like  
Amino Acid Sequences MKVYLLTLLVYIASVFAQDQSFYKDDPNIIELTPSNFDRVVHNTNYTTLVEFYAPWCGYCKQLKNTIHSLGKASDSIFQVAAVNCDKASNKQLCGEYGVEGFPTLKVFKPGKAGKTAVKKHASETYMGERKLAPLINFIKAKIKNHVKKLTSADMVSKLVNSQSSNKYAVVLFSKQSSIPVTYKSIAIDWLDRVKFYCYLNTKKTLVESLKSFESESAEIIGPLVDRIGKLSAGKDKSLLVLIDKENQKISVLEDKITKSNVAKFIIDNTSLKPKEGPYSKRDDYLAKLKLNKKKKTQVQNDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.07
4 0.08
5 0.08
6 0.1
7 0.15
8 0.17
9 0.17
10 0.2
11 0.21
12 0.22
13 0.24
14 0.25
15 0.21
16 0.19
17 0.21
18 0.19
19 0.2
20 0.22
21 0.2
22 0.2
23 0.19
24 0.19
25 0.21
26 0.27
27 0.29
28 0.28
29 0.3
30 0.29
31 0.3
32 0.32
33 0.29
34 0.24
35 0.19
36 0.17
37 0.14
38 0.14
39 0.13
40 0.17
41 0.16
42 0.15
43 0.18
44 0.18
45 0.23
46 0.31
47 0.37
48 0.36
49 0.45
50 0.49
51 0.52
52 0.57
53 0.59
54 0.55
55 0.49
56 0.46
57 0.38
58 0.35
59 0.29
60 0.25
61 0.21
62 0.19
63 0.19
64 0.16
65 0.15
66 0.16
67 0.15
68 0.17
69 0.14
70 0.13
71 0.12
72 0.13
73 0.14
74 0.14
75 0.22
76 0.23
77 0.23
78 0.27
79 0.29
80 0.28
81 0.3
82 0.28
83 0.21
84 0.18
85 0.17
86 0.12
87 0.11
88 0.11
89 0.08
90 0.08
91 0.08
92 0.08
93 0.14
94 0.16
95 0.17
96 0.26
97 0.3
98 0.32
99 0.35
100 0.37
101 0.37
102 0.46
103 0.49
104 0.49
105 0.5
106 0.48
107 0.46
108 0.49
109 0.44
110 0.35
111 0.33
112 0.34
113 0.33
114 0.33
115 0.31
116 0.25
117 0.25
118 0.26
119 0.24
120 0.15
121 0.16
122 0.19
123 0.22
124 0.23
125 0.23
126 0.27
127 0.28
128 0.29
129 0.32
130 0.4
131 0.42
132 0.5
133 0.57
134 0.51
135 0.53
136 0.56
137 0.52
138 0.43
139 0.37
140 0.31
141 0.25
142 0.25
143 0.19
144 0.15
145 0.11
146 0.1
147 0.11
148 0.1
149 0.13
150 0.15
151 0.18
152 0.2
153 0.19
154 0.2
155 0.18
156 0.19
157 0.17
158 0.15
159 0.13
160 0.12
161 0.13
162 0.12
163 0.13
164 0.13
165 0.13
166 0.13
167 0.15
168 0.17
169 0.17
170 0.17
171 0.17
172 0.15
173 0.14
174 0.14
175 0.13
176 0.12
177 0.16
178 0.16
179 0.15
180 0.16
181 0.17
182 0.19
183 0.18
184 0.23
185 0.24
186 0.31
187 0.35
188 0.39
189 0.38
190 0.36
191 0.37
192 0.37
193 0.33
194 0.29
195 0.27
196 0.26
197 0.26
198 0.26
199 0.24
200 0.19
201 0.19
202 0.16
203 0.14
204 0.13
205 0.12
206 0.11
207 0.11
208 0.1
209 0.07
210 0.07
211 0.07
212 0.05
213 0.05
214 0.06
215 0.07
216 0.08
217 0.09
218 0.13
219 0.2
220 0.22
221 0.23
222 0.22
223 0.22
224 0.22
225 0.23
226 0.2
227 0.14
228 0.17
229 0.18
230 0.25
231 0.26
232 0.27
233 0.26
234 0.26
235 0.25
236 0.21
237 0.23
238 0.24
239 0.23
240 0.24
241 0.27
242 0.29
243 0.31
244 0.32
245 0.31
246 0.25
247 0.3
248 0.34
249 0.33
250 0.31
251 0.29
252 0.33
253 0.34
254 0.34
255 0.29
256 0.27
257 0.34
258 0.33
259 0.34
260 0.31
261 0.3
262 0.37
263 0.44
264 0.47
265 0.43
266 0.52
267 0.54
268 0.55
269 0.55
270 0.5
271 0.48
272 0.51
273 0.52
274 0.49
275 0.55
276 0.6
277 0.67
278 0.73
279 0.75
280 0.76
281 0.8
282 0.83
283 0.86
284 0.88