Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3S104

Protein Details
Accession A0A0C3S104   
Localization Confidence High
Confidence Score 19.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-35KPVSNRAPAQKQTKSRVKKTTARKQPLPAGERHydrophilic
227-248QETNVSKKEKSVRLKRVPKGVVHydrophilic
NLS Segment(s)
PositionSequence
17-27KSRVKKTTARK
272-280GGKRRKAGG
296-308QGSKSAGKGKKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013699  Signal_recog_part_SRP72_RNA-bd  
IPR026270  SRP72  
IPR031545  SRP_TPR-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF08492  SRP72  
PF17004  SRP_TPR_like  
Amino Acid Sequences MPPKPVSNRAPAQKQTKSRVKKTTARKQPLPAGERLKRLFTSLCAQIDGGHFENAIKTCDKILKIEPEDKDALQTKVFLLLQTEQYGAALSLTDSNETYVFEKGYSLYRTNQEADALKALEVTKKNKGDDDRGVLHLEAQLAYREGSYQAAFDLYTQLLDTSDPSSEEHADILTNLEAAQKHLDFIDSGHLRALDELPTSISNNLESAPPPQPPSAAATVTSAIALQETNVSKKEKSVRLKRVPKGVVLGVTPLPDPERWLKKSERSTFGTGGKRRKAGGGATQGSVESAPPAPSQGSKSAGKGKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.8
4 0.81
5 0.81
6 0.83
7 0.82
8 0.82
9 0.85
10 0.85
11 0.86
12 0.86
13 0.84
14 0.81
15 0.82
16 0.82
17 0.76
18 0.73
19 0.72
20 0.68
21 0.69
22 0.63
23 0.59
24 0.5
25 0.48
26 0.42
27 0.35
28 0.35
29 0.33
30 0.31
31 0.28
32 0.27
33 0.27
34 0.26
35 0.27
36 0.23
37 0.17
38 0.16
39 0.15
40 0.19
41 0.18
42 0.18
43 0.15
44 0.14
45 0.16
46 0.21
47 0.22
48 0.22
49 0.26
50 0.33
51 0.37
52 0.44
53 0.42
54 0.42
55 0.44
56 0.4
57 0.4
58 0.34
59 0.3
60 0.24
61 0.23
62 0.18
63 0.2
64 0.21
65 0.16
66 0.15
67 0.16
68 0.17
69 0.17
70 0.17
71 0.13
72 0.12
73 0.12
74 0.1
75 0.07
76 0.05
77 0.04
78 0.07
79 0.07
80 0.08
81 0.08
82 0.09
83 0.09
84 0.1
85 0.11
86 0.09
87 0.09
88 0.09
89 0.09
90 0.09
91 0.13
92 0.15
93 0.16
94 0.18
95 0.21
96 0.24
97 0.25
98 0.24
99 0.23
100 0.21
101 0.2
102 0.19
103 0.16
104 0.13
105 0.13
106 0.13
107 0.15
108 0.17
109 0.19
110 0.25
111 0.27
112 0.28
113 0.31
114 0.34
115 0.35
116 0.36
117 0.37
118 0.33
119 0.31
120 0.31
121 0.27
122 0.24
123 0.2
124 0.16
125 0.11
126 0.09
127 0.07
128 0.07
129 0.07
130 0.06
131 0.06
132 0.06
133 0.07
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.05
140 0.06
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.05
149 0.05
150 0.06
151 0.07
152 0.08
153 0.09
154 0.09
155 0.08
156 0.07
157 0.07
158 0.07
159 0.07
160 0.05
161 0.05
162 0.05
163 0.06
164 0.06
165 0.07
166 0.09
167 0.08
168 0.09
169 0.09
170 0.09
171 0.07
172 0.08
173 0.15
174 0.13
175 0.14
176 0.14
177 0.14
178 0.14
179 0.15
180 0.15
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.1
187 0.1
188 0.09
189 0.08
190 0.08
191 0.09
192 0.08
193 0.08
194 0.11
195 0.14
196 0.15
197 0.17
198 0.17
199 0.17
200 0.17
201 0.2
202 0.19
203 0.17
204 0.16
205 0.15
206 0.15
207 0.15
208 0.14
209 0.1
210 0.07
211 0.07
212 0.06
213 0.05
214 0.08
215 0.1
216 0.12
217 0.15
218 0.18
219 0.18
220 0.24
221 0.32
222 0.37
223 0.46
224 0.54
225 0.62
226 0.71
227 0.8
228 0.81
229 0.82
230 0.76
231 0.68
232 0.62
233 0.53
234 0.45
235 0.35
236 0.32
237 0.23
238 0.21
239 0.19
240 0.15
241 0.15
242 0.13
243 0.16
244 0.22
245 0.3
246 0.31
247 0.37
248 0.42
249 0.49
250 0.6
251 0.65
252 0.63
253 0.6
254 0.64
255 0.64
256 0.65
257 0.65
258 0.62
259 0.63
260 0.63
261 0.6
262 0.55
263 0.54
264 0.5
265 0.45
266 0.47
267 0.47
268 0.43
269 0.41
270 0.4
271 0.36
272 0.33
273 0.28
274 0.19
275 0.12
276 0.11
277 0.12
278 0.12
279 0.14
280 0.15
281 0.17
282 0.21
283 0.23
284 0.27
285 0.28
286 0.33
287 0.42
288 0.48