Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FT24

Protein Details
Accession Q6FT24    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31VNVPKTRKTYCKGKACRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cgr:CAGL0G05940g  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKACRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFGGQTKPVFHKKAKTTKKVVLRLECVNCKTKAQLTLKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.88
5 0.87
6 0.88
7 0.87
8 0.87
9 0.85
10 0.85
11 0.87
12 0.8
13 0.8
14 0.74
15 0.69
16 0.62
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.63
32 0.6
33 0.61
34 0.59
35 0.58
36 0.56
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.31
43 0.31
44 0.3
45 0.28
46 0.33
47 0.38
48 0.47
49 0.55
50 0.6
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.66
57 0.61
58 0.6
59 0.59
60 0.57
61 0.51
62 0.48
63 0.42
64 0.38
65 0.36
66 0.33
67 0.36
68 0.4
69 0.46
70 0.49
71 0.59
72 0.66
73 0.7
74 0.68
75 0.63
76 0.59
77 0.53
78 0.53
79 0.53
80 0.53
81 0.55
82 0.62
83 0.59
84 0.59
85 0.61
86 0.57