FuNGI

A0A0C3S1H9

Protein Details

Accession

A0A0C3S1H9

Localization Confidence

Medium

Confidence Score

11.9

NoLS Segment(s)

Position	Sequence	Protein Nature
8-37	SSDKAKKQYDTLKKKYDKMKKSLAQQPNAF	Hydrophilic
71-90	VLPNKPRQKLQRASERRTPV	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 19, cyto_nucl 11.5, mito 2, cyto 2, plas 1, pero 1, cysk 1, vacu 1

Family & Domain DBs

InterPro	View protein in InterPro IPR045341 DUF6532
Pfam	View protein in Pfam PF20149 DUF6532

Amino Acid Sequences

MAVTDKESSDKAKKQYDTLKKKYDKMKKSLAQQPNAFSNSQEGDGSSEGDFESEEETTHGYKSPFVSKGVVLPNKPRQKLQRASERRTPVTGKVPPQPKPQTQSLPPPAVEPLPNRNQSPSLLLSHSSNHSSRASSSLSARLPYDRLLSVASNIPSHRSGSRSSASSSHTNMASSRASSPPLSEASEALLEGNLHSADSEAGAGIQTEGRPRTDSFTQPTTHYRAHRGTTPPLFEPLDEDAPPPFAPKGQPLASDYSKTIEGLINQAVDHVAVRIYTEQAFPLALEKDEWAQEAWLAITRRVSNIRSHLRKIALAEVVAHYGIDRNVQNPGVESANAARVKVLTDDPKPPKFTHKDFDAAHPRRYAEDPFVLRLLQQAIFKNGQDIGPQFRAAFDPLPFTVLALLLTVVEFSLDAWESGSLNTKLEFRAKDYREQYSVHLAELQEWEKSNPEAVLKMRRRMFRRVLELGKITLDGAQGYKVPDHQRERMKAAMEDRTGDTDSD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.58
2	0.67
3	0.71
4	0.73
5	0.76
6	0.79
7	0.77
8	0.82
9	0.85
10	0.85
11	0.83
12	0.81
13	0.82
14	0.78
15	0.81
16	0.83
17	0.82
18	0.8
19	0.76
20	0.72
21	0.69
22	0.65
23	0.56
24	0.46
25	0.41
26	0.34
27	0.3
28	0.25
29	0.18
30	0.18
31	0.18
32	0.19
33	0.14
34	0.13
35	0.11
36	0.11
37	0.1
38	0.08
39	0.09
40	0.08
41	0.08
42	0.08
43	0.1
44	0.11
45	0.12
46	0.15
47	0.13
48	0.16
49	0.2
50	0.26
51	0.26
52	0.27
53	0.29
54	0.26
55	0.33
56	0.39
57	0.41
58	0.37
59	0.44
60	0.52
61	0.59
62	0.61
63	0.62
64	0.62
65	0.67
66	0.73
67	0.73
68	0.74
69	0.74
70	0.8
71	0.81
72	0.8
73	0.73
74	0.68
75	0.63
76	0.57
77	0.56
78	0.55
79	0.52
80	0.52
81	0.57
82	0.57
83	0.64
84	0.67
85	0.64
86	0.64
87	0.66
88	0.65
89	0.63
90	0.68
91	0.65
92	0.61
93	0.55
94	0.5
95	0.45
96	0.39
97	0.37
98	0.31
99	0.31
100	0.35
101	0.38
102	0.38
103	0.39
104	0.38
105	0.36
106	0.36
107	0.31
108	0.26
109	0.23
110	0.23
111	0.22
112	0.23
113	0.24
114	0.24
115	0.22
116	0.22
117	0.22
118	0.22
119	0.21
120	0.22
121	0.22
122	0.2
123	0.21
124	0.24
125	0.24
126	0.24
127	0.24
128	0.23
129	0.22
130	0.21
131	0.22
132	0.16
133	0.15
134	0.16
135	0.15
136	0.15
137	0.17
138	0.17
139	0.16
140	0.16
141	0.18
142	0.18
143	0.19
144	0.19
145	0.18
146	0.19
147	0.22
148	0.25
149	0.24
150	0.25
151	0.26
152	0.28
153	0.3
154	0.3
155	0.27
156	0.25
157	0.23
158	0.22
159	0.22
160	0.19
161	0.16
162	0.17
163	0.15
164	0.17
165	0.16
166	0.17
167	0.16
168	0.17
169	0.17
170	0.15
171	0.13
172	0.13
173	0.13
174	0.12
175	0.09
176	0.08
177	0.06
178	0.06
179	0.06
180	0.05
181	0.04
182	0.04
183	0.05
184	0.04
185	0.04
186	0.04
187	0.03
188	0.03
189	0.03
190	0.04
191	0.03
192	0.04
193	0.05
194	0.07
195	0.08
196	0.09
197	0.11
198	0.12
199	0.16
200	0.19
201	0.22
202	0.24
203	0.27
204	0.27
205	0.28
206	0.31
207	0.31
208	0.33
209	0.31
210	0.33
211	0.33
212	0.33
213	0.36
214	0.36
215	0.38
216	0.37
217	0.37
218	0.32
219	0.32
220	0.3
221	0.24
222	0.23
223	0.19
224	0.18
225	0.15
226	0.15
227	0.12
228	0.13
229	0.13
230	0.12
231	0.09
232	0.08
233	0.08
234	0.1
235	0.15
236	0.14
237	0.16
238	0.16
239	0.21
240	0.21
241	0.22
242	0.2
243	0.17
244	0.16
245	0.15
246	0.14
247	0.1
248	0.09
249	0.1
250	0.1
251	0.09
252	0.09
253	0.09
254	0.08
255	0.07
256	0.06
257	0.04
258	0.04
259	0.03
260	0.04
261	0.04
262	0.06
263	0.06
264	0.07
265	0.06
266	0.07
267	0.07
268	0.06
269	0.08
270	0.08
271	0.07
272	0.07
273	0.08
274	0.08
275	0.09
276	0.09
277	0.07
278	0.07
279	0.07
280	0.07
281	0.06
282	0.09
283	0.09
284	0.09
285	0.12
286	0.12
287	0.15
288	0.18
289	0.19
290	0.19
291	0.27
292	0.36
293	0.39
294	0.41
295	0.44
296	0.42
297	0.42
298	0.39
299	0.35
300	0.26
301	0.21
302	0.2
303	0.16
304	0.15
305	0.13
306	0.11
307	0.07
308	0.07
309	0.07
310	0.09
311	0.09
312	0.09
313	0.12
314	0.13
315	0.13
316	0.12
317	0.14
318	0.12
319	0.11
320	0.11
321	0.1
322	0.17
323	0.17
324	0.16
325	0.14
326	0.13
327	0.14
328	0.15
329	0.18
330	0.16
331	0.19
332	0.29
333	0.35
334	0.4
335	0.43
336	0.42
337	0.48
338	0.5
339	0.53
340	0.5
341	0.47
342	0.5
343	0.48
344	0.56
345	0.57
346	0.54
347	0.52
348	0.48
349	0.45
350	0.41
351	0.42
352	0.35
353	0.29
354	0.31
355	0.3
356	0.29
357	0.29
358	0.26
359	0.24
360	0.23
361	0.21
362	0.17
363	0.18
364	0.18
365	0.22
366	0.23
367	0.23
368	0.23
369	0.22
370	0.2
371	0.19
372	0.19
373	0.21
374	0.21
375	0.22
376	0.2
377	0.19
378	0.2
379	0.2
380	0.2
381	0.15
382	0.17
383	0.16
384	0.18
385	0.17
386	0.15
387	0.13
388	0.11
389	0.1
390	0.07
391	0.07
392	0.05
393	0.05
394	0.05
395	0.04
396	0.04
397	0.03
398	0.03
399	0.05
400	0.06
401	0.06
402	0.06
403	0.07
404	0.08
405	0.09
406	0.15
407	0.13
408	0.14
409	0.15
410	0.16
411	0.18
412	0.24
413	0.25
414	0.25
415	0.35
416	0.37
417	0.45
418	0.48
419	0.52
420	0.49
421	0.49
422	0.46
423	0.46
424	0.44
425	0.35
426	0.34
427	0.28
428	0.28
429	0.3
430	0.28
431	0.21
432	0.21
433	0.21
434	0.21
435	0.21
436	0.2
437	0.17
438	0.18
439	0.2
440	0.24
441	0.34
442	0.38
443	0.45
444	0.5
445	0.57
446	0.6
447	0.66
448	0.7
449	0.69
450	0.71
451	0.71
452	0.7
453	0.68
454	0.66
455	0.58
456	0.49
457	0.4
458	0.32
459	0.25
460	0.2
461	0.14
462	0.12
463	0.12
464	0.13
465	0.15
466	0.16
467	0.21
468	0.27
469	0.35
470	0.41
471	0.48
472	0.56
473	0.61
474	0.65
475	0.63
476	0.6
477	0.57
478	0.56
479	0.56
480	0.48
481	0.46
482	0.43
483	0.42

A0A0C3S1H9

3D AlphaFold-predicted Structure Viewer