Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PC95

Protein Details
Accession A0A0C3PC95    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-47LESRFSTQQQRRVRKRLRRRGSTAAGRHydrophilic
NLS Segment(s)
PositionSequence
31-41RRVRKRLRRRG
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MTASSVFNGLQFIERLGDHGLESRFSTQQQRRVRKRLRRRGSTAAGRTAGLYEWPRICSRRLRGPRCAASVRRLTGESRVAPCSRRPDSHGRNKNTHMSRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.13
5 0.11
6 0.15
7 0.15
8 0.14
9 0.16
10 0.17
11 0.17
12 0.18
13 0.28
14 0.29
15 0.37
16 0.46
17 0.56
18 0.62
19 0.71
20 0.79
21 0.8
22 0.86
23 0.88
24 0.89
25 0.87
26 0.85
27 0.83
28 0.81
29 0.8
30 0.72
31 0.64
32 0.55
33 0.46
34 0.38
35 0.3
36 0.22
37 0.15
38 0.12
39 0.11
40 0.11
41 0.13
42 0.14
43 0.15
44 0.18
45 0.23
46 0.27
47 0.35
48 0.45
49 0.49
50 0.56
51 0.63
52 0.65
53 0.64
54 0.65
55 0.57
56 0.54
57 0.54
58 0.47
59 0.41
60 0.38
61 0.33
62 0.32
63 0.34
64 0.32
65 0.29
66 0.31
67 0.31
68 0.32
69 0.36
70 0.4
71 0.41
72 0.4
73 0.43
74 0.5
75 0.58
76 0.67
77 0.72
78 0.71
79 0.73
80 0.75
81 0.79
82 0.74