Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FM36

Protein Details
Accession Q6FM36   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
141-161ETVAKKEKPMKHKVEHDPKLLBasic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, mito 5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR022533  Cox20  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0051082  F:unfolded protein binding  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
GO:0043069  P:negative regulation of programmed cell death  
KEGG cgr:CAGL0K11341g  -  
Pfam View protein in Pfam  
PF12597  Cox20  
Amino Acid Sequences MWNPFKKSEEKPQVAEDLPTNYTPGQKILLEDTRPKFQSDISKGDVAASKEQASLRAAWESISWNDFTLEKLTSIPCFRDAGMVGFSSMFVTGSVILLYHKNINKAMNWAVGGLMLGSIVGWEQCRMKRKRSFQVAQMAMETVAKKEKPMKHKVEHDPKLLDQWEGRSGLKPNGPSDSKPWYKFW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.49
3 0.4
4 0.33
5 0.3
6 0.27
7 0.25
8 0.2
9 0.22
10 0.21
11 0.2
12 0.18
13 0.17
14 0.18
15 0.22
16 0.27
17 0.28
18 0.35
19 0.37
20 0.42
21 0.42
22 0.42
23 0.36
24 0.35
25 0.41
26 0.39
27 0.4
28 0.37
29 0.37
30 0.36
31 0.37
32 0.37
33 0.29
34 0.26
35 0.23
36 0.19
37 0.2
38 0.2
39 0.2
40 0.18
41 0.16
42 0.15
43 0.14
44 0.13
45 0.11
46 0.12
47 0.12
48 0.12
49 0.13
50 0.11
51 0.11
52 0.11
53 0.11
54 0.12
55 0.11
56 0.1
57 0.09
58 0.1
59 0.11
60 0.12
61 0.13
62 0.13
63 0.12
64 0.13
65 0.12
66 0.13
67 0.13
68 0.12
69 0.12
70 0.11
71 0.09
72 0.08
73 0.08
74 0.07
75 0.06
76 0.05
77 0.03
78 0.04
79 0.04
80 0.04
81 0.04
82 0.03
83 0.04
84 0.05
85 0.06
86 0.1
87 0.11
88 0.13
89 0.15
90 0.16
91 0.16
92 0.19
93 0.2
94 0.17
95 0.15
96 0.14
97 0.12
98 0.11
99 0.1
100 0.06
101 0.04
102 0.03
103 0.02
104 0.02
105 0.02
106 0.02
107 0.03
108 0.03
109 0.04
110 0.08
111 0.12
112 0.22
113 0.26
114 0.35
115 0.44
116 0.52
117 0.61
118 0.69
119 0.69
120 0.67
121 0.74
122 0.67
123 0.59
124 0.51
125 0.41
126 0.31
127 0.28
128 0.22
129 0.13
130 0.15
131 0.14
132 0.16
133 0.24
134 0.31
135 0.38
136 0.48
137 0.56
138 0.6
139 0.69
140 0.78
141 0.81
142 0.8
143 0.78
144 0.72
145 0.64
146 0.62
147 0.54
148 0.45
149 0.36
150 0.33
151 0.31
152 0.29
153 0.29
154 0.26
155 0.28
156 0.32
157 0.34
158 0.34
159 0.33
160 0.38
161 0.41
162 0.4
163 0.42
164 0.46
165 0.5