Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FXT4

Protein Details
Accession Q6FXT4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-53SNGDLLSRKKKENRKPTKDEILKKCKEBasic
NLS Segment(s)
PositionSequence
34-42RKKKENRKP
Subcellular Location(s) cyto 20, cyto_nucl 12.333, cyto_mito 11.333, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023476  Pep_tRNA_hydro_II_dom_sf  
IPR002833  PTH2  
Gene Ontology GO:0016020  C:membrane  
GO:0004045  F:aminoacyl-tRNA hydrolase activity  
GO:0032435  P:negative regulation of proteasomal ubiquitin-dependent protein catabolic process  
KEGG cgr:CAGL0A04323g  -  
Pfam View protein in Pfam  
PF01981  PTH2  
CDD cd02430  PTH2  
Amino Acid Sequences MGSNIIPSFFGIAVASLATGYYLGTLSNGDLLSRKKKENRKPTKDEILKKCKETAEATANAESEDEEETDDEDYDEGELSDEEIESLSLNDIPGEVRMALVIRQDLGMQKGKVAAQCAHAALSCFRLIATDPNKMSYNPELTKRWLRHGQAKITLKCPDKEKMDELYAMAISLGVNAAVIHDAGRTQIAAGSATVLGLGPAPKAVLDQITGELKLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.05
4 0.05
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.06
14 0.08
15 0.08
16 0.08
17 0.12
18 0.17
19 0.25
20 0.29
21 0.37
22 0.44
23 0.54
24 0.64
25 0.72
26 0.79
27 0.8
28 0.84
29 0.85
30 0.88
31 0.87
32 0.86
33 0.85
34 0.85
35 0.79
36 0.73
37 0.69
38 0.59
39 0.54
40 0.47
41 0.43
42 0.39
43 0.36
44 0.36
45 0.33
46 0.31
47 0.27
48 0.24
49 0.17
50 0.12
51 0.1
52 0.07
53 0.06
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.05
82 0.04
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.06
92 0.06
93 0.09
94 0.12
95 0.11
96 0.11
97 0.13
98 0.14
99 0.14
100 0.15
101 0.14
102 0.13
103 0.14
104 0.14
105 0.13
106 0.12
107 0.12
108 0.1
109 0.11
110 0.09
111 0.07
112 0.07
113 0.07
114 0.08
115 0.14
116 0.17
117 0.21
118 0.21
119 0.24
120 0.25
121 0.25
122 0.27
123 0.23
124 0.27
125 0.24
126 0.29
127 0.29
128 0.33
129 0.41
130 0.4
131 0.44
132 0.44
133 0.46
134 0.51
135 0.55
136 0.56
137 0.57
138 0.63
139 0.59
140 0.56
141 0.59
142 0.53
143 0.5
144 0.47
145 0.45
146 0.41
147 0.43
148 0.42
149 0.4
150 0.38
151 0.36
152 0.32
153 0.27
154 0.22
155 0.17
156 0.13
157 0.09
158 0.06
159 0.06
160 0.05
161 0.03
162 0.03
163 0.03
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.05
170 0.05
171 0.06
172 0.06
173 0.06
174 0.07
175 0.08
176 0.08
177 0.08
178 0.09
179 0.08
180 0.08
181 0.08
182 0.06
183 0.06
184 0.06
185 0.07
186 0.06
187 0.06
188 0.06
189 0.06
190 0.07
191 0.09
192 0.09
193 0.1
194 0.11
195 0.14
196 0.17