Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3PQL8

Protein Details
Accession A0A0C3PQL8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
64-83QQWGAVQRKKDKKATSTPAHHydrophilic
NLS Segment(s)
PositionSequence
89-120HAGSRERTEFRGGRGGRGGRGGPGRGGAARGA
Subcellular Location(s) nucl 13.5, cyto_nucl 10, mito 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003892  CUE  
IPR041803  DEF1_CUE  
IPR009060  UBA-like_sf  
Gene Ontology GO:0000781  C:chromosome, telomeric region  
GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0043130  F:ubiquitin binding  
Pfam View protein in Pfam  
PF02845  CUE  
PROSITE View protein in PROSITE  
PS51140  CUE  
CDD cd14368  CUE_DEF1_like  
Amino Acid Sequences MYNSSAYRRPQASTDATPEKYRTQIQQIKDVFPDWSSEDIQSVLVDASGDVDLAVNRISEGHAQQWGAVQRKKDKKATSTPAHVQSKEHAGSRERTEFRGGRGGRGGRGGPGRGGAARGAFARGGHQETNGRHAIAGPSKNGDVVATKTEEVPAADYAAADANGVKTIEDAPVPEPVVEVTSTPTSWGGDTVTNGTIAPAPVATPSQPPHTTAKPVKTPATSKLSWAQIAKPQEKPTPPPAPVPVPAPVTAPAPVTPAAQLPAPQAAPAPESVHPEPQPEPFVQGWEDPTTVQVPTWDDEPAQPTPAKPAALAVPEEPKIKEEEEPVTIPPATPAAQPEVVDRVLSALPPQVQPAQAKPEAVQAPAPVKPTTPAQHTRPTSAALRHKFKADQAVIMPSGSFTSLEKVGMQFGSLSLGGDDFDANAQETYAEPATRAPEPVAAPEPQVPSQPAQPPSLQARSTGPESASVVTSPPVQTPSSTGPSLFQGIPQQAQQQPQISPSSQVASAAQLQSQSGLPSSLSQPALPAQVPAQPQSSASVSNISSYSHNIPAVPPSLPSHQHPQGNQTQGLLSQQHQQQYSQHSLPSHLDQSQAAVQSPHAAPAPQQSLGGHSSYFRQQEPPYFHTATPPVSASQSQDGPYGAFGQLSAQLGHQNQASHLGGFGGGDYPYGETQRNFYDSYSGPTGFGNRNMLGHEDIKGLPGAPQQPHGGAPGLPPSNAQPSQQLPQSSQSASQGQPGGQGPQQSYPPPLPYYYTPYPQNQYYGSPYNSGYSVPQPFVKYPTVFQGPPGPQSAPSPAAKQAQSSVQPQSPYGQGLYGQQHSSSPYGDIDYQGHGQGVSGLPSNDYGKQLYGGSAQGMQGFMGLGQGAGPSGAQRGGGSPEAAYKPYGGGAAKDVGAGQGAQQQARGAGGAQQPQGGFYGAQRFAGAATAGPQGAQAQQHQPQGQGPQGHLGYSQGSSDAGFYPYQPRQQGYWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.5
4 0.52
5 0.52
6 0.49
7 0.47
8 0.46
9 0.44
10 0.47
11 0.51
12 0.51
13 0.57
14 0.58
15 0.57
16 0.54
17 0.49
18 0.39
19 0.33
20 0.32
21 0.25
22 0.25
23 0.23
24 0.21
25 0.2
26 0.19
27 0.19
28 0.16
29 0.14
30 0.1
31 0.08
32 0.07
33 0.06
34 0.07
35 0.07
36 0.07
37 0.06
38 0.07
39 0.07
40 0.07
41 0.08
42 0.06
43 0.06
44 0.07
45 0.09
46 0.12
47 0.14
48 0.17
49 0.2
50 0.2
51 0.2
52 0.25
53 0.3
54 0.35
55 0.36
56 0.4
57 0.47
58 0.57
59 0.64
60 0.68
61 0.69
62 0.7
63 0.77
64 0.81
65 0.79
66 0.78
67 0.78
68 0.79
69 0.79
70 0.71
71 0.62
72 0.56
73 0.56
74 0.5
75 0.46
76 0.41
77 0.38
78 0.43
79 0.48
80 0.53
81 0.46
82 0.46
83 0.5
84 0.48
85 0.47
86 0.51
87 0.45
88 0.4
89 0.45
90 0.46
91 0.39
92 0.41
93 0.38
94 0.33
95 0.37
96 0.34
97 0.27
98 0.26
99 0.25
100 0.22
101 0.22
102 0.18
103 0.15
104 0.15
105 0.14
106 0.14
107 0.13
108 0.13
109 0.15
110 0.17
111 0.21
112 0.2
113 0.22
114 0.27
115 0.28
116 0.34
117 0.32
118 0.29
119 0.25
120 0.25
121 0.28
122 0.29
123 0.31
124 0.27
125 0.28
126 0.28
127 0.28
128 0.26
129 0.21
130 0.17
131 0.16
132 0.18
133 0.17
134 0.17
135 0.17
136 0.18
137 0.18
138 0.16
139 0.16
140 0.13
141 0.12
142 0.11
143 0.1
144 0.1
145 0.1
146 0.1
147 0.08
148 0.07
149 0.07
150 0.08
151 0.08
152 0.08
153 0.07
154 0.08
155 0.1
156 0.09
157 0.11
158 0.1
159 0.13
160 0.14
161 0.13
162 0.12
163 0.11
164 0.12
165 0.11
166 0.1
167 0.1
168 0.11
169 0.11
170 0.12
171 0.13
172 0.12
173 0.12
174 0.12
175 0.11
176 0.1
177 0.12
178 0.13
179 0.13
180 0.13
181 0.12
182 0.12
183 0.12
184 0.11
185 0.1
186 0.07
187 0.07
188 0.08
189 0.09
190 0.09
191 0.12
192 0.14
193 0.21
194 0.22
195 0.25
196 0.29
197 0.32
198 0.4
199 0.42
200 0.47
201 0.47
202 0.51
203 0.53
204 0.52
205 0.52
206 0.51
207 0.52
208 0.45
209 0.41
210 0.43
211 0.41
212 0.4
213 0.38
214 0.34
215 0.33
216 0.4
217 0.41
218 0.41
219 0.43
220 0.46
221 0.48
222 0.51
223 0.53
224 0.53
225 0.51
226 0.5
227 0.49
228 0.46
229 0.44
230 0.41
231 0.36
232 0.31
233 0.29
234 0.26
235 0.23
236 0.2
237 0.19
238 0.17
239 0.13
240 0.13
241 0.13
242 0.12
243 0.12
244 0.11
245 0.11
246 0.11
247 0.11
248 0.11
249 0.13
250 0.12
251 0.12
252 0.11
253 0.11
254 0.12
255 0.12
256 0.13
257 0.13
258 0.19
259 0.2
260 0.25
261 0.25
262 0.27
263 0.27
264 0.27
265 0.28
266 0.22
267 0.25
268 0.2
269 0.21
270 0.19
271 0.19
272 0.18
273 0.17
274 0.17
275 0.13
276 0.14
277 0.14
278 0.12
279 0.11
280 0.11
281 0.11
282 0.11
283 0.12
284 0.11
285 0.11
286 0.12
287 0.16
288 0.15
289 0.16
290 0.15
291 0.15
292 0.19
293 0.21
294 0.2
295 0.16
296 0.17
297 0.16
298 0.18
299 0.19
300 0.15
301 0.16
302 0.18
303 0.2
304 0.18
305 0.17
306 0.17
307 0.17
308 0.18
309 0.17
310 0.18
311 0.19
312 0.2
313 0.2
314 0.2
315 0.19
316 0.17
317 0.14
318 0.13
319 0.11
320 0.1
321 0.11
322 0.12
323 0.14
324 0.14
325 0.15
326 0.16
327 0.15
328 0.14
329 0.12
330 0.11
331 0.1
332 0.1
333 0.09
334 0.09
335 0.1
336 0.11
337 0.13
338 0.12
339 0.15
340 0.16
341 0.18
342 0.22
343 0.21
344 0.21
345 0.2
346 0.26
347 0.24
348 0.23
349 0.22
350 0.17
351 0.19
352 0.2
353 0.22
354 0.15
355 0.14
356 0.15
357 0.19
358 0.21
359 0.25
360 0.29
361 0.31
362 0.39
363 0.41
364 0.42
365 0.39
366 0.38
367 0.35
368 0.36
369 0.4
370 0.39
371 0.43
372 0.41
373 0.43
374 0.41
375 0.39
376 0.41
377 0.33
378 0.29
379 0.24
380 0.26
381 0.23
382 0.22
383 0.2
384 0.11
385 0.1
386 0.08
387 0.07
388 0.05
389 0.07
390 0.07
391 0.08
392 0.08
393 0.08
394 0.09
395 0.08
396 0.08
397 0.06
398 0.06
399 0.07
400 0.06
401 0.06
402 0.05
403 0.05
404 0.05
405 0.05
406 0.05
407 0.04
408 0.04
409 0.04
410 0.04
411 0.04
412 0.04
413 0.04
414 0.04
415 0.06
416 0.07
417 0.07
418 0.06
419 0.08
420 0.1
421 0.1
422 0.11
423 0.09
424 0.11
425 0.11
426 0.13
427 0.14
428 0.13
429 0.13
430 0.16
431 0.18
432 0.15
433 0.16
434 0.15
435 0.14
436 0.18
437 0.22
438 0.22
439 0.22
440 0.21
441 0.23
442 0.27
443 0.3
444 0.25
445 0.21
446 0.21
447 0.21
448 0.22
449 0.2
450 0.16
451 0.13
452 0.14
453 0.14
454 0.12
455 0.1
456 0.08
457 0.08
458 0.09
459 0.08
460 0.08
461 0.09
462 0.09
463 0.09
464 0.12
465 0.15
466 0.17
467 0.17
468 0.16
469 0.15
470 0.15
471 0.18
472 0.15
473 0.12
474 0.11
475 0.12
476 0.13
477 0.13
478 0.16
479 0.16
480 0.18
481 0.19
482 0.19
483 0.19
484 0.2
485 0.21
486 0.17
487 0.16
488 0.15
489 0.14
490 0.12
491 0.12
492 0.1
493 0.09
494 0.11
495 0.1
496 0.1
497 0.08
498 0.08
499 0.09
500 0.09
501 0.08
502 0.06
503 0.06
504 0.05
505 0.06
506 0.08
507 0.1
508 0.11
509 0.1
510 0.11
511 0.11
512 0.13
513 0.12
514 0.11
515 0.08
516 0.12
517 0.13
518 0.13
519 0.14
520 0.12
521 0.13
522 0.14
523 0.14
524 0.11
525 0.11
526 0.12
527 0.1
528 0.11
529 0.12
530 0.11
531 0.11
532 0.12
533 0.14
534 0.13
535 0.13
536 0.12
537 0.13
538 0.14
539 0.15
540 0.12
541 0.11
542 0.12
543 0.15
544 0.17
545 0.19
546 0.24
547 0.27
548 0.3
549 0.3
550 0.33
551 0.36
552 0.38
553 0.36
554 0.29
555 0.24
556 0.21
557 0.23
558 0.19
559 0.13
560 0.16
561 0.18
562 0.22
563 0.22
564 0.22
565 0.24
566 0.28
567 0.32
568 0.27
569 0.26
570 0.23
571 0.25
572 0.26
573 0.25
574 0.22
575 0.18
576 0.18
577 0.16
578 0.17
579 0.17
580 0.16
581 0.13
582 0.11
583 0.1
584 0.13
585 0.13
586 0.13
587 0.11
588 0.1
589 0.1
590 0.15
591 0.18
592 0.14
593 0.15
594 0.13
595 0.16
596 0.17
597 0.17
598 0.12
599 0.1
600 0.12
601 0.16
602 0.18
603 0.16
604 0.19
605 0.2
606 0.27
607 0.33
608 0.34
609 0.37
610 0.37
611 0.36
612 0.35
613 0.36
614 0.31
615 0.26
616 0.23
617 0.17
618 0.17
619 0.18
620 0.16
621 0.16
622 0.17
623 0.16
624 0.16
625 0.15
626 0.14
627 0.13
628 0.13
629 0.1
630 0.08
631 0.07
632 0.07
633 0.09
634 0.1
635 0.1
636 0.08
637 0.11
638 0.12
639 0.13
640 0.14
641 0.12
642 0.12
643 0.16
644 0.16
645 0.13
646 0.13
647 0.11
648 0.1
649 0.09
650 0.09
651 0.05
652 0.05
653 0.05
654 0.05
655 0.06
656 0.07
657 0.09
658 0.1
659 0.09
660 0.12
661 0.14
662 0.17
663 0.16
664 0.16
665 0.19
666 0.18
667 0.22
668 0.23
669 0.21
670 0.19
671 0.19
672 0.23
673 0.2
674 0.22
675 0.2
676 0.18
677 0.18
678 0.18
679 0.2
680 0.19
681 0.18
682 0.17
683 0.15
684 0.15
685 0.15
686 0.14
687 0.12
688 0.11
689 0.14
690 0.18
691 0.16
692 0.19
693 0.19
694 0.2
695 0.21
696 0.2
697 0.18
698 0.13
699 0.14
700 0.18
701 0.17
702 0.16
703 0.16
704 0.17
705 0.23
706 0.24
707 0.24
708 0.21
709 0.24
710 0.28
711 0.31
712 0.3
713 0.25
714 0.28
715 0.31
716 0.27
717 0.26
718 0.25
719 0.25
720 0.25
721 0.27
722 0.24
723 0.21
724 0.23
725 0.23
726 0.22
727 0.2
728 0.22
729 0.19
730 0.21
731 0.23
732 0.21
733 0.24
734 0.23
735 0.25
736 0.24
737 0.24
738 0.24
739 0.25
740 0.32
741 0.32
742 0.35
743 0.36
744 0.39
745 0.43
746 0.41
747 0.41
748 0.34
749 0.33
750 0.34
751 0.35
752 0.32
753 0.3
754 0.29
755 0.27
756 0.26
757 0.24
758 0.2
759 0.2
760 0.21
761 0.21
762 0.24
763 0.25
764 0.26
765 0.3
766 0.32
767 0.28
768 0.26
769 0.32
770 0.33
771 0.3
772 0.31
773 0.35
774 0.33
775 0.34
776 0.35
777 0.29
778 0.25
779 0.28
780 0.31
781 0.26
782 0.26
783 0.26
784 0.27
785 0.32
786 0.31
787 0.3
788 0.29
789 0.3
790 0.33
791 0.34
792 0.35
793 0.32
794 0.33
795 0.32
796 0.32
797 0.28
798 0.26
799 0.22
800 0.17
801 0.15
802 0.19
803 0.23
804 0.24
805 0.23
806 0.21
807 0.22
808 0.24
809 0.24
810 0.19
811 0.16
812 0.14
813 0.16
814 0.16
815 0.17
816 0.16
817 0.18
818 0.18
819 0.17
820 0.17
821 0.14
822 0.13
823 0.13
824 0.12
825 0.11
826 0.11
827 0.11
828 0.11
829 0.13
830 0.16
831 0.16
832 0.17
833 0.17
834 0.16
835 0.17
836 0.17
837 0.16
838 0.16
839 0.14
840 0.14
841 0.14
842 0.14
843 0.13
844 0.13
845 0.11
846 0.09
847 0.09
848 0.07
849 0.06
850 0.05
851 0.04
852 0.04
853 0.04
854 0.04
855 0.04
856 0.04
857 0.04
858 0.06
859 0.06
860 0.07
861 0.07
862 0.09
863 0.12
864 0.14
865 0.14
866 0.13
867 0.19
868 0.2
869 0.21
870 0.2
871 0.17
872 0.16
873 0.17
874 0.19
875 0.14
876 0.13
877 0.15
878 0.16
879 0.16
880 0.15
881 0.14
882 0.12
883 0.12
884 0.11
885 0.09
886 0.12
887 0.14
888 0.14
889 0.14
890 0.15
891 0.15
892 0.15
893 0.14
894 0.1
895 0.14
896 0.19
897 0.23
898 0.23
899 0.25
900 0.25
901 0.25
902 0.26
903 0.21
904 0.16
905 0.14
906 0.22
907 0.2
908 0.21
909 0.2
910 0.19
911 0.18
912 0.19
913 0.16
914 0.08
915 0.1
916 0.12
917 0.11
918 0.11
919 0.11
920 0.11
921 0.14
922 0.16
923 0.18
924 0.23
925 0.29
926 0.36
927 0.37
928 0.38
929 0.39
930 0.41
931 0.43
932 0.39
933 0.34
934 0.35
935 0.34
936 0.32
937 0.29
938 0.26
939 0.22
940 0.19
941 0.19
942 0.12
943 0.11
944 0.11
945 0.13
946 0.13
947 0.12
948 0.12
949 0.13
950 0.21
951 0.26
952 0.33
953 0.35
954 0.36