Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FT82

Protein Details
Accession Q6FT82    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-115ESIKQPTKFKARPFKKCSDNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR045298  Complex1_LYR_LYRM7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0044183  F:protein folding chaperone  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
KEGG cgr:CAGL0G04653g  -  
CDD cd20267  Complex1_LYR_LYRM7  
Amino Acid Sequences MIPEALRKQALIAYKHGLRATRVAFDGDNRVLLAARAEMRKGMENPDSSKTTQEQIQHLEEVATFLKRNLVQGQKIEGEEKYHLKIHKDIELGDNESIKQPTKFKARPFKKCSDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.36
4 0.34
5 0.3
6 0.33
7 0.31
8 0.28
9 0.27
10 0.25
11 0.23
12 0.23
13 0.27
14 0.21
15 0.19
16 0.16
17 0.15
18 0.13
19 0.13
20 0.11
21 0.08
22 0.1
23 0.11
24 0.11
25 0.12
26 0.13
27 0.17
28 0.17
29 0.19
30 0.2
31 0.22
32 0.24
33 0.27
34 0.29
35 0.26
36 0.27
37 0.24
38 0.21
39 0.23
40 0.23
41 0.21
42 0.22
43 0.23
44 0.21
45 0.19
46 0.18
47 0.14
48 0.12
49 0.1
50 0.08
51 0.06
52 0.06
53 0.1
54 0.1
55 0.12
56 0.16
57 0.2
58 0.22
59 0.24
60 0.27
61 0.25
62 0.26
63 0.26
64 0.2
65 0.19
66 0.19
67 0.2
68 0.2
69 0.22
70 0.24
71 0.25
72 0.29
73 0.3
74 0.32
75 0.31
76 0.3
77 0.3
78 0.31
79 0.31
80 0.28
81 0.25
82 0.21
83 0.22
84 0.23
85 0.21
86 0.21
87 0.21
88 0.27
89 0.37
90 0.42
91 0.49
92 0.59
93 0.67
94 0.75
95 0.79