Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3NIR0

Protein Details
Accession A0A0C3NIR0   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-105YRKGIHKVPKWTRRTLRTNPKGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTAVSLGGLLWKIPWRLSTTRKANVRKRLRAVDSVIEAVRASGVECGSLNKALELPKEHEMPPKDKYTTYSPYGRGYRKGIHKVPKWTRRTLRTNPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.13
5 0.14
6 0.14
7 0.15
8 0.19
9 0.25
10 0.31
11 0.4
12 0.44
13 0.51
14 0.59
15 0.67
16 0.7
17 0.74
18 0.78
19 0.77
20 0.76
21 0.76
22 0.71
23 0.66
24 0.6
25 0.53
26 0.45
27 0.38
28 0.31
29 0.23
30 0.19
31 0.14
32 0.11
33 0.07
34 0.06
35 0.05
36 0.05
37 0.05
38 0.05
39 0.06
40 0.07
41 0.08
42 0.07
43 0.06
44 0.08
45 0.09
46 0.11
47 0.12
48 0.15
49 0.18
50 0.2
51 0.21
52 0.26
53 0.28
54 0.3
55 0.31
56 0.33
57 0.31
58 0.3
59 0.33
60 0.34
61 0.36
62 0.37
63 0.38
64 0.36
65 0.41
66 0.47
67 0.47
68 0.45
69 0.44
70 0.47
71 0.51
72 0.57
73 0.58
74 0.61
75 0.65
76 0.71
77 0.78
78 0.8
79 0.77
80 0.78
81 0.8
82 0.79
83 0.82
84 0.82
85 0.83