Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3S7T1

Protein Details
Accession A0A0C3S7T1   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
259-302DDDRRHSRSRGSRRSERRAERRERRQERREMKRGRRSEGRAGKTBasic
NLS Segment(s)
PositionSequence
262-306RRHSRSRGSRRSERRAERRERRQERREMKRGRRSEGRAGKTDKKE
Subcellular Location(s) nucl 16, cyto 5, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028018  DUF4646  
Pfam View protein in Pfam  
PF15496  DUF4646  
Amino Acid Sequences MIVDRKDAIPEQTIRMQYDAPQGPPPGYHESASNPFADPAARGYPPSPNYNTYNSSPGGEAPAFYGQQPALAHGSYNQHLSPGPSSSQPRTPSPSGSSSGFFAKSASLESLLNPPPPAFARAPQAQFPYSPPFATHDVNEEDWTRFLGDLQKIGALSPMNRIVSNVAPLAMGIGFLPGLLVTRAFESRMKTNKAGPASQLVEYWNSHYFHPRMMDVALVQGQTVYGSAAGLPPQMAQQGSSRSRGDYDSDSSSSSSSSDDDRRHSRSRGSRRSERRAERRERRQERREMKRGRRSEGRAGKTDKKEPWRLVVSYRPSQMM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.36
3 0.34
4 0.31
5 0.38
6 0.37
7 0.32
8 0.34
9 0.34
10 0.32
11 0.33
12 0.34
13 0.32
14 0.3
15 0.28
16 0.25
17 0.3
18 0.35
19 0.35
20 0.32
21 0.25
22 0.23
23 0.23
24 0.22
25 0.16
26 0.15
27 0.17
28 0.17
29 0.17
30 0.18
31 0.25
32 0.28
33 0.34
34 0.34
35 0.34
36 0.38
37 0.41
38 0.45
39 0.4
40 0.4
41 0.35
42 0.32
43 0.28
44 0.25
45 0.24
46 0.2
47 0.17
48 0.15
49 0.17
50 0.16
51 0.15
52 0.17
53 0.12
54 0.15
55 0.15
56 0.15
57 0.14
58 0.14
59 0.14
60 0.15
61 0.19
62 0.17
63 0.19
64 0.17
65 0.16
66 0.17
67 0.19
68 0.17
69 0.16
70 0.16
71 0.19
72 0.24
73 0.26
74 0.32
75 0.33
76 0.35
77 0.4
78 0.4
79 0.39
80 0.39
81 0.39
82 0.35
83 0.34
84 0.31
85 0.25
86 0.26
87 0.22
88 0.18
89 0.15
90 0.13
91 0.11
92 0.11
93 0.1
94 0.09
95 0.09
96 0.1
97 0.15
98 0.16
99 0.17
100 0.16
101 0.15
102 0.16
103 0.16
104 0.19
105 0.15
106 0.15
107 0.2
108 0.25
109 0.27
110 0.28
111 0.3
112 0.27
113 0.26
114 0.27
115 0.26
116 0.22
117 0.2
118 0.18
119 0.19
120 0.22
121 0.22
122 0.2
123 0.18
124 0.19
125 0.19
126 0.2
127 0.18
128 0.15
129 0.14
130 0.14
131 0.11
132 0.08
133 0.09
134 0.13
135 0.12
136 0.12
137 0.12
138 0.12
139 0.12
140 0.12
141 0.12
142 0.07
143 0.07
144 0.09
145 0.12
146 0.11
147 0.11
148 0.12
149 0.12
150 0.12
151 0.13
152 0.1
153 0.08
154 0.07
155 0.07
156 0.07
157 0.05
158 0.05
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.02
165 0.03
166 0.03
167 0.03
168 0.03
169 0.05
170 0.05
171 0.07
172 0.09
173 0.12
174 0.18
175 0.25
176 0.28
177 0.29
178 0.33
179 0.36
180 0.37
181 0.36
182 0.3
183 0.29
184 0.27
185 0.26
186 0.23
187 0.19
188 0.18
189 0.17
190 0.19
191 0.18
192 0.17
193 0.17
194 0.22
195 0.22
196 0.22
197 0.24
198 0.21
199 0.18
200 0.17
201 0.17
202 0.11
203 0.13
204 0.11
205 0.09
206 0.09
207 0.07
208 0.07
209 0.07
210 0.07
211 0.05
212 0.03
213 0.03
214 0.04
215 0.04
216 0.05
217 0.05
218 0.05
219 0.05
220 0.06
221 0.08
222 0.08
223 0.09
224 0.11
225 0.19
226 0.21
227 0.26
228 0.26
229 0.25
230 0.27
231 0.27
232 0.27
233 0.23
234 0.25
235 0.25
236 0.25
237 0.25
238 0.24
239 0.23
240 0.2
241 0.16
242 0.13
243 0.1
244 0.14
245 0.19
246 0.22
247 0.28
248 0.34
249 0.4
250 0.45
251 0.47
252 0.52
253 0.56
254 0.64
255 0.68
256 0.71
257 0.75
258 0.8
259 0.87
260 0.88
261 0.89
262 0.88
263 0.88
264 0.9
265 0.91
266 0.92
267 0.92
268 0.93
269 0.93
270 0.91
271 0.92
272 0.91
273 0.91
274 0.91
275 0.9
276 0.9
277 0.9
278 0.88
279 0.85
280 0.84
281 0.8
282 0.81
283 0.8
284 0.76
285 0.74
286 0.75
287 0.77
288 0.74
289 0.76
290 0.74
291 0.73
292 0.76
293 0.71
294 0.72
295 0.69
296 0.64
297 0.62
298 0.62
299 0.61
300 0.58