Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PTY6

Protein Details
Accession A0A0C3PTY6   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
111-133AGRPRDRVPRRRHTRTPPPPPPPBasic
NLS Segment(s)
PositionSequence
111-130AGRPRDRVPRRRHTRTPPPP
Subcellular Location(s) cyto_nucl 9.5, cyto 8.5, mito 8, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013785  Aldolase_TIM  
IPR003830  ComA_synth  
IPR036112  ComA_synth_sf  
Pfam View protein in Pfam  
PF02679  ComA  
Amino Acid Sequences MPEERLKLLIDVAHKHDCYVSTRGFIERVLATSGGSPQVVSKYFTDCKNMGFDVLEISSDFLSIPTASWLSLIEDTKKHGLKSKPEVGIQWGAGGDAPVARVCRHTRPALAGRPRDRVPRRRHTRTPPPPPPPLARSTAPDPGTQMIMIESEGTTENVASWRTDAISAISSALPAAKIAADPAVFAYHVQNQGAEADLFVDRTQILQLACLRKGIWGSGSTFGRIVTYGGHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.32
4 0.31
5 0.31
6 0.32
7 0.28
8 0.25
9 0.26
10 0.28
11 0.27
12 0.25
13 0.24
14 0.19
15 0.19
16 0.18
17 0.16
18 0.14
19 0.15
20 0.16
21 0.14
22 0.13
23 0.11
24 0.1
25 0.14
26 0.15
27 0.16
28 0.16
29 0.21
30 0.25
31 0.27
32 0.32
33 0.29
34 0.29
35 0.3
36 0.29
37 0.24
38 0.2
39 0.18
40 0.15
41 0.14
42 0.13
43 0.09
44 0.09
45 0.08
46 0.08
47 0.07
48 0.05
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.08
58 0.11
59 0.12
60 0.13
61 0.14
62 0.17
63 0.22
64 0.24
65 0.23
66 0.27
67 0.31
68 0.37
69 0.45
70 0.5
71 0.47
72 0.47
73 0.47
74 0.43
75 0.4
76 0.32
77 0.24
78 0.16
79 0.12
80 0.11
81 0.1
82 0.06
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.09
89 0.12
90 0.17
91 0.21
92 0.22
93 0.22
94 0.27
95 0.33
96 0.37
97 0.42
98 0.44
99 0.43
100 0.47
101 0.47
102 0.51
103 0.53
104 0.54
105 0.56
106 0.61
107 0.67
108 0.71
109 0.77
110 0.77
111 0.82
112 0.83
113 0.85
114 0.83
115 0.8
116 0.75
117 0.71
118 0.66
119 0.58
120 0.51
121 0.45
122 0.36
123 0.34
124 0.33
125 0.35
126 0.32
127 0.29
128 0.27
129 0.23
130 0.22
131 0.18
132 0.15
133 0.08
134 0.07
135 0.07
136 0.06
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.07
145 0.08
146 0.07
147 0.07
148 0.07
149 0.08
150 0.08
151 0.08
152 0.08
153 0.08
154 0.09
155 0.09
156 0.09
157 0.08
158 0.08
159 0.08
160 0.06
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.07
167 0.06
168 0.07
169 0.08
170 0.08
171 0.08
172 0.09
173 0.11
174 0.14
175 0.16
176 0.16
177 0.15
178 0.15
179 0.15
180 0.16
181 0.14
182 0.09
183 0.08
184 0.08
185 0.09
186 0.09
187 0.09
188 0.07
189 0.08
190 0.09
191 0.1
192 0.09
193 0.12
194 0.18
195 0.23
196 0.23
197 0.24
198 0.24
199 0.23
200 0.25
201 0.23
202 0.2
203 0.18
204 0.2
205 0.26
206 0.27
207 0.26
208 0.25
209 0.23
210 0.21
211 0.19
212 0.17