Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3S107

Protein Details
Accession A0A0C3S107   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-34LEEKKSQYKHDKYHPLKFNCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10plas 10, E.R. 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008580  PPPDE_dom  
IPR042266  PPPDE_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0008233  F:peptidase activity  
Pfam View protein in Pfam  
PF05903  Peptidase_C97  
PROSITE View protein in PROSITE  
PS51858  PPPDE  
Amino Acid Sequences MGYTTVSRERFESWLEEKKSQYKHDKYHPLKFNCNSFTEECVEFLTGRAVPEWLLGQPQLLATTPRGELICSLLTICYLPPARLGFRLLRMYLTHCTAMAAVPALIGILPTALVTSSGFVGVVKMARVIEEAEIPPPIPFLGGWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.43
4 0.44
5 0.5
6 0.53
7 0.56
8 0.6
9 0.59
10 0.63
11 0.69
12 0.76
13 0.76
14 0.8
15 0.81
16 0.77
17 0.77
18 0.74
19 0.71
20 0.63
21 0.58
22 0.53
23 0.44
24 0.41
25 0.35
26 0.31
27 0.24
28 0.21
29 0.2
30 0.15
31 0.14
32 0.13
33 0.1
34 0.1
35 0.1
36 0.09
37 0.08
38 0.08
39 0.09
40 0.07
41 0.07
42 0.07
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.08
51 0.08
52 0.1
53 0.09
54 0.09
55 0.09
56 0.1
57 0.1
58 0.08
59 0.08
60 0.06
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.08
67 0.1
68 0.11
69 0.12
70 0.13
71 0.16
72 0.14
73 0.18
74 0.2
75 0.19
76 0.18
77 0.18
78 0.21
79 0.2
80 0.21
81 0.17
82 0.15
83 0.15
84 0.13
85 0.13
86 0.1
87 0.08
88 0.05
89 0.05
90 0.05
91 0.04
92 0.04
93 0.03
94 0.03
95 0.02
96 0.02
97 0.02
98 0.03
99 0.03
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.07
110 0.07
111 0.08
112 0.08
113 0.08
114 0.09
115 0.1
116 0.1
117 0.13
118 0.13
119 0.13
120 0.14
121 0.14
122 0.13
123 0.13
124 0.12
125 0.09