Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FUQ2

Protein Details
Accession Q6FUQ2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
145-173PDKMPEETKSKRQMKREKRGDDKVKYKYRBasic
NLS Segment(s)
PositionSequence
153-171KSKRQMKREKRGDDKVKYK
Subcellular Location(s) mito 19, mito_nucl 12.333, cyto_mito 10.333, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008506  SND2/TMEM208  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0005773  C:vacuole  
GO:0006624  P:vacuolar protein processing  
KEGG cgr:CAGL0F01617g  -  
Pfam View protein in Pfam  
PF05620  TMEM208_SND2  
Amino Acid Sequences MAGKATKKQAASNSNTLNTLHKVAGPVLVLAFLRTVLGSNNTYIKFVMFNLPMCACLYILEKTGRPQYDSKGKVVREGMDLSQAGGMTEYMFDLIYLSIIANVGRIIFNTNKWWYLLLLCPIYVGYKLYSLKQQYFGSTPGPVIPDKMPEETKSKRQMKREKRGDDKVKYKYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.53
3 0.49
4 0.44
5 0.38
6 0.33
7 0.25
8 0.21
9 0.2
10 0.19
11 0.2
12 0.17
13 0.14
14 0.11
15 0.12
16 0.1
17 0.09
18 0.08
19 0.06
20 0.06
21 0.05
22 0.06
23 0.06
24 0.1
25 0.1
26 0.12
27 0.17
28 0.17
29 0.18
30 0.17
31 0.17
32 0.14
33 0.14
34 0.18
35 0.15
36 0.15
37 0.17
38 0.17
39 0.18
40 0.17
41 0.17
42 0.11
43 0.11
44 0.12
45 0.1
46 0.13
47 0.14
48 0.14
49 0.16
50 0.22
51 0.22
52 0.22
53 0.23
54 0.26
55 0.34
56 0.36
57 0.37
58 0.37
59 0.36
60 0.37
61 0.37
62 0.33
63 0.26
64 0.25
65 0.21
66 0.18
67 0.17
68 0.14
69 0.12
70 0.11
71 0.08
72 0.07
73 0.06
74 0.04
75 0.04
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.07
94 0.08
95 0.1
96 0.14
97 0.16
98 0.16
99 0.17
100 0.17
101 0.15
102 0.16
103 0.17
104 0.16
105 0.15
106 0.14
107 0.13
108 0.13
109 0.13
110 0.12
111 0.1
112 0.07
113 0.11
114 0.12
115 0.14
116 0.2
117 0.24
118 0.26
119 0.3
120 0.3
121 0.29
122 0.3
123 0.31
124 0.26
125 0.23
126 0.21
127 0.17
128 0.19
129 0.16
130 0.17
131 0.16
132 0.19
133 0.21
134 0.25
135 0.26
136 0.26
137 0.34
138 0.37
139 0.45
140 0.5
141 0.57
142 0.6
143 0.68
144 0.76
145 0.8
146 0.85
147 0.87
148 0.87
149 0.87
150 0.91
151 0.91
152 0.9
153 0.89