Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FKI7

Protein Details
Accession Q6FKI7   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
212-242IYKELGSKKNKSKNSSKPRRRSPVDNENKELHydrophilic
NLS Segment(s)
PositionSequence
219-232KKNKSKNSSKPRRR
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR017231  Small_GTPase_Tem1/Spg1  
Gene Ontology GO:0005816  C:spindle pole body  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0044877  F:protein-containing complex binding  
GO:0040001  P:establishment of mitotic spindle localization  
GO:0031578  P:mitotic spindle orientation checkpoint signaling  
GO:1904750  P:negative regulation of protein localization to nucleolus  
GO:0031536  P:positive regulation of exit from mitosis  
GO:0023056  P:positive regulation of signaling  
GO:1902542  P:regulation of protein localization to mitotic spindle pole body  
KEGG cgr:CAGL0L11242g  -  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
CDD cd04128  Spg1  
Amino Acid Sequences MSASEMRAASERVGEERNSLPSVRNQVDIQVGLIGDAQVGKTSLMVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIATLGSSVIILLFDLTRPETLNSIKEWYRQALGLNDSAIPILVGTKYDLFIDLEEEYQEKVSKTSMKYAQVMDAPLIFCSTAKSINIQKIFKVALAKIFDLTLTIPEINEIGDPLLIYKELGSKKNKSKNSSKPRRRSPVDNENKELVSQPHNYGHTSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.24
4 0.27
5 0.26
6 0.26
7 0.25
8 0.28
9 0.36
10 0.34
11 0.35
12 0.31
13 0.31
14 0.34
15 0.31
16 0.26
17 0.18
18 0.16
19 0.13
20 0.13
21 0.1
22 0.07
23 0.07
24 0.06
25 0.05
26 0.06
27 0.06
28 0.06
29 0.08
30 0.09
31 0.1
32 0.12
33 0.12
34 0.18
35 0.22
36 0.23
37 0.22
38 0.23
39 0.22
40 0.21
41 0.22
42 0.16
43 0.14
44 0.13
45 0.12
46 0.11
47 0.09
48 0.1
49 0.11
50 0.17
51 0.17
52 0.2
53 0.22
54 0.23
55 0.27
56 0.31
57 0.35
58 0.34
59 0.37
60 0.37
61 0.37
62 0.36
63 0.33
64 0.28
65 0.21
66 0.16
67 0.13
68 0.09
69 0.08
70 0.06
71 0.07
72 0.06
73 0.07
74 0.07
75 0.06
76 0.07
77 0.06
78 0.09
79 0.08
80 0.07
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.04
97 0.05
98 0.05
99 0.06
100 0.07
101 0.08
102 0.1
103 0.11
104 0.11
105 0.14
106 0.15
107 0.17
108 0.18
109 0.17
110 0.17
111 0.16
112 0.16
113 0.15
114 0.16
115 0.13
116 0.12
117 0.11
118 0.1
119 0.09
120 0.08
121 0.05
122 0.04
123 0.04
124 0.03
125 0.03
126 0.04
127 0.05
128 0.05
129 0.05
130 0.06
131 0.06
132 0.06
133 0.07
134 0.07
135 0.07
136 0.07
137 0.08
138 0.07
139 0.08
140 0.09
141 0.07
142 0.07
143 0.09
144 0.14
145 0.14
146 0.22
147 0.26
148 0.28
149 0.3
150 0.31
151 0.31
152 0.28
153 0.27
154 0.21
155 0.17
156 0.14
157 0.12
158 0.11
159 0.08
160 0.07
161 0.08
162 0.09
163 0.09
164 0.09
165 0.13
166 0.18
167 0.25
168 0.31
169 0.3
170 0.29
171 0.3
172 0.31
173 0.29
174 0.27
175 0.21
176 0.21
177 0.23
178 0.23
179 0.2
180 0.2
181 0.18
182 0.15
183 0.14
184 0.1
185 0.09
186 0.09
187 0.08
188 0.08
189 0.09
190 0.08
191 0.08
192 0.07
193 0.05
194 0.05
195 0.05
196 0.06
197 0.06
198 0.06
199 0.06
200 0.06
201 0.13
202 0.17
203 0.24
204 0.3
205 0.38
206 0.48
207 0.57
208 0.64
209 0.65
210 0.72
211 0.77
212 0.82
213 0.85
214 0.86
215 0.87
216 0.91
217 0.93
218 0.9
219 0.89
220 0.87
221 0.87
222 0.87
223 0.84
224 0.79
225 0.73
226 0.66
227 0.57
228 0.51
229 0.43
230 0.37
231 0.33
232 0.32
233 0.34
234 0.36