Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3S9S0

Protein Details
Accession A0A0C3S9S0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-46VLLYSVPRRNRPRPTWTIRRVLWHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 13, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR013094  AB_hydrolase_3  
Gene Ontology GO:0016020  C:membrane  
GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF07859  Abhydrolase_3  
Amino Acid Sequences MALFQTLLAILETFTVIFVRLPLVLLYSVPRRNRPRPTWTIRRVLWLHVLKNGYLHRLAGKNPDHTAITGGPGVKGVWVAPTPHLIQGEVKEWAELAGVESVSIPGYWMDKQGSDIPACAPPAEGEIVLMHLHGGAYTALSAHPSSAPSAIPRGILKHVKAIKRTFNLEYRLTKPPATTPENPFPAALLDAIAGYSYLVNEVGFAPENIVVEGDSAGGNLALALVRYLVEQQGKGDALLPRPPSALLLLSPWSDLSIRGHNPDSSVYTCLPTDFVDTTTADYAAITLQYLGPLGRRGADTNRYVSPGSDSPHVGEISFAGFPRTLIFAGGAEALRDQIRTLRAKMTADLGESVEYHEFPDAIHDFIAMPIIEPERSQALEIIAKWVDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.07
6 0.08
7 0.08
8 0.09
9 0.08
10 0.1
11 0.1
12 0.1
13 0.14
14 0.2
15 0.27
16 0.31
17 0.41
18 0.48
19 0.57
20 0.67
21 0.71
22 0.73
23 0.77
24 0.82
25 0.84
26 0.83
27 0.83
28 0.74
29 0.75
30 0.67
31 0.61
32 0.61
33 0.56
34 0.49
35 0.46
36 0.46
37 0.37
38 0.4
39 0.38
40 0.32
41 0.27
42 0.26
43 0.26
44 0.28
45 0.3
46 0.33
47 0.36
48 0.37
49 0.37
50 0.39
51 0.34
52 0.32
53 0.33
54 0.24
55 0.21
56 0.19
57 0.18
58 0.15
59 0.14
60 0.14
61 0.11
62 0.1
63 0.08
64 0.09
65 0.1
66 0.11
67 0.12
68 0.16
69 0.17
70 0.19
71 0.19
72 0.17
73 0.18
74 0.19
75 0.21
76 0.2
77 0.18
78 0.15
79 0.15
80 0.14
81 0.12
82 0.1
83 0.08
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.06
92 0.05
93 0.07
94 0.07
95 0.1
96 0.1
97 0.1
98 0.13
99 0.17
100 0.2
101 0.18
102 0.18
103 0.18
104 0.19
105 0.19
106 0.17
107 0.13
108 0.1
109 0.11
110 0.11
111 0.09
112 0.07
113 0.07
114 0.08
115 0.07
116 0.07
117 0.05
118 0.04
119 0.04
120 0.04
121 0.05
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.05
130 0.06
131 0.07
132 0.08
133 0.08
134 0.09
135 0.09
136 0.11
137 0.11
138 0.12
139 0.12
140 0.13
141 0.17
142 0.21
143 0.2
144 0.26
145 0.31
146 0.34
147 0.39
148 0.42
149 0.44
150 0.43
151 0.47
152 0.43
153 0.42
154 0.43
155 0.41
156 0.41
157 0.39
158 0.41
159 0.39
160 0.36
161 0.31
162 0.31
163 0.33
164 0.35
165 0.35
166 0.35
167 0.4
168 0.42
169 0.42
170 0.37
171 0.31
172 0.25
173 0.21
174 0.14
175 0.07
176 0.05
177 0.04
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.04
188 0.04
189 0.05
190 0.05
191 0.05
192 0.06
193 0.06
194 0.06
195 0.06
196 0.06
197 0.05
198 0.05
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.03
205 0.03
206 0.03
207 0.03
208 0.02
209 0.02
210 0.02
211 0.02
212 0.03
213 0.03
214 0.04
215 0.06
216 0.07
217 0.08
218 0.08
219 0.1
220 0.1
221 0.1
222 0.13
223 0.13
224 0.14
225 0.18
226 0.19
227 0.18
228 0.18
229 0.18
230 0.15
231 0.14
232 0.13
233 0.09
234 0.09
235 0.1
236 0.1
237 0.1
238 0.09
239 0.09
240 0.08
241 0.09
242 0.1
243 0.15
244 0.16
245 0.19
246 0.21
247 0.21
248 0.22
249 0.22
250 0.23
251 0.18
252 0.2
253 0.17
254 0.17
255 0.16
256 0.16
257 0.15
258 0.12
259 0.14
260 0.12
261 0.12
262 0.13
263 0.13
264 0.14
265 0.14
266 0.14
267 0.1
268 0.09
269 0.09
270 0.07
271 0.07
272 0.05
273 0.05
274 0.05
275 0.05
276 0.06
277 0.06
278 0.06
279 0.08
280 0.09
281 0.1
282 0.11
283 0.14
284 0.19
285 0.25
286 0.27
287 0.29
288 0.3
289 0.31
290 0.3
291 0.28
292 0.28
293 0.25
294 0.24
295 0.24
296 0.23
297 0.22
298 0.25
299 0.25
300 0.19
301 0.16
302 0.14
303 0.13
304 0.13
305 0.11
306 0.1
307 0.1
308 0.1
309 0.11
310 0.13
311 0.1
312 0.1
313 0.11
314 0.09
315 0.1
316 0.12
317 0.1
318 0.09
319 0.09
320 0.1
321 0.1
322 0.1
323 0.09
324 0.12
325 0.18
326 0.22
327 0.25
328 0.28
329 0.31
330 0.33
331 0.34
332 0.35
333 0.3
334 0.27
335 0.26
336 0.22
337 0.2
338 0.18
339 0.19
340 0.15
341 0.14
342 0.13
343 0.12
344 0.11
345 0.1
346 0.16
347 0.15
348 0.15
349 0.15
350 0.14
351 0.14
352 0.14
353 0.17
354 0.1
355 0.09
356 0.11
357 0.13
358 0.13
359 0.13
360 0.15
361 0.16
362 0.17
363 0.17
364 0.16
365 0.17
366 0.21
367 0.21
368 0.24
369 0.21