Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3NKF4

Protein Details
Accession A0A0C3NKF4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
172-198DKDKIVQVFRDKKRRIKKAEIPNTYIEHydrophilic
NLS Segment(s)
PositionSequence
183-189KKRRIKK
Subcellular Location(s) mito 12.5, cyto_mito 11.833, cyto 10, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR008906  HATC_C_dom  
IPR012337  RNaseH-like_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF05699  Dimer_Tnp_hAT  
Amino Acid Sequences LEKAVKDRTLAKVIRVAAARGLGVLNKYYSKTDDSIMYRLTMILQPKYKTEYFRLHEWPEDWIAVAKQLLREHGENHYKTGAKDVLDMYLSTPQVPNVGDPLLYWQSQLAGGNPLAQMALDVLSAPASSIDVERAFSRGGLTVSKRRHALSDKSVRAATVLSSWASFEGIIDKDKIVQVFRDKKRRIKKAEIPNTYIEILGDEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.33
4 0.26
5 0.25
6 0.22
7 0.17
8 0.16
9 0.13
10 0.12
11 0.13
12 0.13
13 0.14
14 0.15
15 0.17
16 0.19
17 0.21
18 0.21
19 0.22
20 0.26
21 0.28
22 0.29
23 0.28
24 0.26
25 0.23
26 0.21
27 0.21
28 0.18
29 0.18
30 0.21
31 0.25
32 0.25
33 0.27
34 0.32
35 0.33
36 0.34
37 0.36
38 0.4
39 0.39
40 0.44
41 0.48
42 0.45
43 0.45
44 0.42
45 0.39
46 0.31
47 0.27
48 0.21
49 0.16
50 0.13
51 0.12
52 0.12
53 0.1
54 0.12
55 0.12
56 0.14
57 0.16
58 0.17
59 0.18
60 0.24
61 0.31
62 0.28
63 0.29
64 0.31
65 0.29
66 0.28
67 0.31
68 0.26
69 0.18
70 0.19
71 0.18
72 0.15
73 0.15
74 0.15
75 0.11
76 0.12
77 0.12
78 0.1
79 0.1
80 0.09
81 0.1
82 0.1
83 0.09
84 0.07
85 0.07
86 0.07
87 0.06
88 0.1
89 0.1
90 0.1
91 0.1
92 0.09
93 0.09
94 0.1
95 0.1
96 0.07
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.07
103 0.07
104 0.06
105 0.04
106 0.04
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.06
118 0.06
119 0.07
120 0.07
121 0.09
122 0.09
123 0.08
124 0.09
125 0.09
126 0.09
127 0.12
128 0.16
129 0.23
130 0.26
131 0.3
132 0.32
133 0.31
134 0.36
135 0.38
136 0.41
137 0.44
138 0.5
139 0.49
140 0.5
141 0.5
142 0.44
143 0.39
144 0.32
145 0.22
146 0.14
147 0.13
148 0.1
149 0.1
150 0.1
151 0.1
152 0.1
153 0.09
154 0.07
155 0.09
156 0.1
157 0.12
158 0.12
159 0.12
160 0.14
161 0.16
162 0.18
163 0.16
164 0.19
165 0.28
166 0.37
167 0.46
168 0.55
169 0.6
170 0.69
171 0.78
172 0.84
173 0.83
174 0.83
175 0.84
176 0.85
177 0.89
178 0.86
179 0.8
180 0.74
181 0.69
182 0.58
183 0.49
184 0.37