Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PDR8

Protein Details
Accession A0A0C3PDR8    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
139-164SKPHAARNSQPKRVRSPRRKPPCTPFHydrophilic
NLS Segment(s)
PositionSequence
147-158SQPKRVRSPRRK
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
Amino Acid Sequences MHTPRERRPSSRSCAALCAALNKNAPAVACARSNGSHKNRLHVQLDAARRVQHWCQCGTLNVRKPCSWAAAAGVRPPLSKWQALSLNALCNATAARLPNIFARPRQVMLQDTLRTDRGKIGWRRNPGNQPTDHSAHCHSKPHAARNSQPKRVRSPRRKPPCTPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.53
3 0.47
4 0.39
5 0.38
6 0.32
7 0.31
8 0.31
9 0.26
10 0.26
11 0.23
12 0.22
13 0.16
14 0.16
15 0.14
16 0.14
17 0.15
18 0.17
19 0.19
20 0.23
21 0.31
22 0.35
23 0.41
24 0.41
25 0.47
26 0.51
27 0.54
28 0.52
29 0.44
30 0.42
31 0.39
32 0.43
33 0.39
34 0.35
35 0.3
36 0.28
37 0.31
38 0.31
39 0.29
40 0.27
41 0.25
42 0.26
43 0.26
44 0.28
45 0.32
46 0.35
47 0.39
48 0.41
49 0.43
50 0.41
51 0.42
52 0.4
53 0.36
54 0.28
55 0.2
56 0.18
57 0.19
58 0.19
59 0.18
60 0.18
61 0.16
62 0.15
63 0.15
64 0.17
65 0.16
66 0.16
67 0.15
68 0.18
69 0.2
70 0.21
71 0.24
72 0.2
73 0.2
74 0.2
75 0.19
76 0.14
77 0.11
78 0.1
79 0.07
80 0.08
81 0.07
82 0.07
83 0.08
84 0.09
85 0.12
86 0.16
87 0.17
88 0.17
89 0.21
90 0.22
91 0.23
92 0.24
93 0.23
94 0.21
95 0.23
96 0.28
97 0.25
98 0.25
99 0.26
100 0.27
101 0.25
102 0.24
103 0.23
104 0.21
105 0.28
106 0.34
107 0.42
108 0.47
109 0.55
110 0.6
111 0.64
112 0.71
113 0.69
114 0.67
115 0.59
116 0.58
117 0.57
118 0.55
119 0.47
120 0.42
121 0.4
122 0.41
123 0.41
124 0.41
125 0.37
126 0.43
127 0.49
128 0.54
129 0.57
130 0.56
131 0.62
132 0.66
133 0.74
134 0.75
135 0.76
136 0.73
137 0.75
138 0.79
139 0.83
140 0.83
141 0.84
142 0.85
143 0.89
144 0.92