Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3RZJ9

Protein Details
Accession A0A0C3RZJ9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-28GEKLRPPPWRRRRIGSGPITBasic
NLS Segment(s)
PositionSequence
7-38PGGEKLRPPPWRRRRIGSGPITHGPHGRGTRR
Subcellular Location(s) mito 14, cyto 7, nucl 6
Family & Domain DBs
Amino Acid Sequences MKVPRIPGGEKLRPPPWRRRRIGSGPITHGPHGRGTRRAVRSETDSPGGHGPAADLPRREVRDAAGRHIPRAVTGSLAPRHSSEVCVPPCTRHQVDVTLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.69
3 0.71
4 0.73
5 0.74
6 0.75
7 0.77
8 0.77
9 0.81
10 0.79
11 0.74
12 0.7
13 0.69
14 0.63
15 0.55
16 0.47
17 0.39
18 0.36
19 0.35
20 0.32
21 0.31
22 0.33
23 0.41
24 0.43
25 0.45
26 0.41
27 0.38
28 0.41
29 0.41
30 0.38
31 0.33
32 0.29
33 0.27
34 0.26
35 0.23
36 0.17
37 0.12
38 0.1
39 0.09
40 0.12
41 0.12
42 0.11
43 0.13
44 0.18
45 0.2
46 0.21
47 0.18
48 0.19
49 0.25
50 0.26
51 0.28
52 0.32
53 0.31
54 0.31
55 0.32
56 0.3
57 0.22
58 0.24
59 0.2
60 0.13
61 0.14
62 0.2
63 0.22
64 0.23
65 0.24
66 0.22
67 0.26
68 0.25
69 0.27
70 0.25
71 0.3
72 0.31
73 0.35
74 0.35
75 0.35
76 0.4
77 0.45
78 0.43
79 0.38
80 0.38