Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6CS01

Protein Details
Accession Q6CS01    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKKRASNGRNKKGRGHVKPVRCVNCHydrophilic
83-110IVRVRSRTDRRIRAPPQRPRFNRDNKVSHydrophilic
NLS Segment(s)
PositionSequence
3-18KKRASNGRNKKGRGHV
91-102DRRIRAPPQRPR
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG kla:KLLA0_D05115g  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRASNGRNKKGRGHVKPVRCVNCSRSVPKDKAIKRMAIRNIVEAAAIRDLSEASVYAEYALPKTYNKLHYCISCAIHARIVRVRSRTDRRIRAPPQRPRFNRDNKVSPADAAKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.79
3 0.78
4 0.77
5 0.76
6 0.81
7 0.82
8 0.78
9 0.7
10 0.67
11 0.61
12 0.62
13 0.59
14 0.55
15 0.54
16 0.56
17 0.56
18 0.59
19 0.63
20 0.57
21 0.61
22 0.59
23 0.57
24 0.53
25 0.58
26 0.56
27 0.54
28 0.51
29 0.43
30 0.4
31 0.33
32 0.29
33 0.21
34 0.17
35 0.1
36 0.09
37 0.07
38 0.06
39 0.06
40 0.06
41 0.05
42 0.04
43 0.04
44 0.05
45 0.04
46 0.05
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.07
53 0.09
54 0.13
55 0.2
56 0.21
57 0.24
58 0.27
59 0.27
60 0.3
61 0.32
62 0.29
63 0.24
64 0.26
65 0.24
66 0.25
67 0.24
68 0.24
69 0.25
70 0.27
71 0.29
72 0.29
73 0.34
74 0.39
75 0.47
76 0.54
77 0.59
78 0.65
79 0.67
80 0.74
81 0.78
82 0.79
83 0.81
84 0.82
85 0.83
86 0.85
87 0.84
88 0.81
89 0.82
90 0.82
91 0.82
92 0.8
93 0.78
94 0.74
95 0.75
96 0.69
97 0.61
98 0.59
99 0.55