Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3RPT6

Protein Details
Accession A0A0C3RPT6   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-101TVLCRFRAASRKKPPNTDRRLRTGPPHydrophilic
NLS Segment(s)
PositionSequence
87-88KK
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MSARCVYRRSPPPSLSSLRTPAPRALSRLHLMCVAVQTFLLEGAACARKHGDGMRARRSDHGRMYKRSRLMTRPCTVLCRFRAASRKKPPNTDRRLRTGPPRATNLAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.57
3 0.53
4 0.49
5 0.46
6 0.46
7 0.44
8 0.41
9 0.43
10 0.41
11 0.39
12 0.37
13 0.37
14 0.37
15 0.36
16 0.32
17 0.27
18 0.24
19 0.21
20 0.2
21 0.15
22 0.11
23 0.09
24 0.08
25 0.07
26 0.06
27 0.06
28 0.04
29 0.03
30 0.06
31 0.1
32 0.1
33 0.1
34 0.11
35 0.11
36 0.12
37 0.14
38 0.18
39 0.21
40 0.27
41 0.36
42 0.37
43 0.38
44 0.42
45 0.45
46 0.43
47 0.44
48 0.48
49 0.46
50 0.52
51 0.58
52 0.59
53 0.59
54 0.6
55 0.57
56 0.56
57 0.59
58 0.59
59 0.56
60 0.54
61 0.51
62 0.51
63 0.49
64 0.48
65 0.41
66 0.4
67 0.38
68 0.39
69 0.48
70 0.5
71 0.57
72 0.61
73 0.69
74 0.68
75 0.77
76 0.81
77 0.82
78 0.84
79 0.84
80 0.8
81 0.79
82 0.81
83 0.76
84 0.77
85 0.76
86 0.75
87 0.72
88 0.71