Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3NVQ7

Protein Details
Accession A0A0C3NVQ7    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
38-66PEASMPSTSSKKKKKKRSRALKALDAMKGHydrophilic
NLS Segment(s)
PositionSequence
48-60KKKKKKRSRALKA
Subcellular Location(s) cyto 13.5, cyto_nucl 11.5, nucl 8.5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000903  NMT  
IPR022677  NMT_C  
IPR022678  NMT_CS  
IPR022676  NMT_N  
Gene Ontology GO:0004379  F:glycylpeptide N-tetradecanoyltransferase activity  
GO:0006499  P:N-terminal protein myristoylation  
Pfam View protein in Pfam  
PF01233  NMT  
PF02799  NMT_C  
PROSITE View protein in PROSITE  
PS00975  NMT_1  
Amino Acid Sequences MSTNNGKARAIEVIEEDSGHQSSASEGSDDELNSSTLPEASMPSTSSKKKKKKRSRALKALDAMKGGKELPQDLVDVVLGKVKETGQAPQADEATVRAALEAMKIRDVIQGKAGLGGVGKKDTGGHKFWGTQPVPQLGEEAPSSDGYIEPSRPSSELRQEPYPLPKDFVWSTVDVTNDEELRELWELLSANYVEDDDEAFRFQYSMEFLRWALIPPGYYKEWHVAVRVASNKKLVAFIAGLPITLRVRDNVFKASEVNFLCVHKKLRSKRLAPVLIKEVTRQCNLKGVFQALYTSGTVLPTPVSVCKYFHRCLNVPKLVAVQFTHVPANQTLARMKLLNKVPEKLKLEKDGLREMEEKDLPEVTALYAAYMSRFGMVIQLTEEEARHQFFSGRGEGPGSWKKPREKQVIWTYVVENPQTHKITDFVSFYSLPSTIMNEPKHNVLYAAYLYYYATDVAFQHGADDDGRLKRRLEDLVGDALVIANEAKFDVFNCLTLMDNPSFLTSLRFGGGSGLLNFYLYNWRTAQLAGMTPVDGMPAGRGIGVPMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.21
4 0.19
5 0.18
6 0.16
7 0.13
8 0.1
9 0.11
10 0.13
11 0.13
12 0.1
13 0.1
14 0.12
15 0.14
16 0.14
17 0.15
18 0.13
19 0.13
20 0.12
21 0.13
22 0.12
23 0.1
24 0.1
25 0.09
26 0.1
27 0.11
28 0.12
29 0.13
30 0.17
31 0.24
32 0.32
33 0.42
34 0.51
35 0.6
36 0.69
37 0.79
38 0.86
39 0.9
40 0.93
41 0.95
42 0.95
43 0.96
44 0.94
45 0.92
46 0.88
47 0.83
48 0.74
49 0.65
50 0.55
51 0.44
52 0.37
53 0.28
54 0.23
55 0.19
56 0.18
57 0.18
58 0.18
59 0.18
60 0.16
61 0.17
62 0.14
63 0.13
64 0.11
65 0.12
66 0.11
67 0.1
68 0.12
69 0.11
70 0.15
71 0.15
72 0.19
73 0.21
74 0.25
75 0.26
76 0.27
77 0.28
78 0.24
79 0.23
80 0.2
81 0.17
82 0.13
83 0.11
84 0.08
85 0.08
86 0.08
87 0.11
88 0.15
89 0.14
90 0.15
91 0.15
92 0.16
93 0.21
94 0.23
95 0.2
96 0.19
97 0.2
98 0.19
99 0.2
100 0.19
101 0.14
102 0.13
103 0.15
104 0.12
105 0.11
106 0.11
107 0.1
108 0.13
109 0.17
110 0.21
111 0.22
112 0.24
113 0.25
114 0.29
115 0.32
116 0.39
117 0.35
118 0.34
119 0.35
120 0.37
121 0.35
122 0.32
123 0.31
124 0.21
125 0.22
126 0.19
127 0.16
128 0.12
129 0.11
130 0.11
131 0.1
132 0.1
133 0.11
134 0.13
135 0.13
136 0.13
137 0.15
138 0.16
139 0.17
140 0.19
141 0.21
142 0.28
143 0.33
144 0.36
145 0.38
146 0.4
147 0.42
148 0.48
149 0.48
150 0.4
151 0.37
152 0.33
153 0.34
154 0.32
155 0.3
156 0.25
157 0.2
158 0.21
159 0.2
160 0.2
161 0.16
162 0.17
163 0.17
164 0.14
165 0.13
166 0.11
167 0.09
168 0.11
169 0.11
170 0.09
171 0.08
172 0.09
173 0.1
174 0.09
175 0.11
176 0.09
177 0.08
178 0.08
179 0.08
180 0.06
181 0.06
182 0.07
183 0.06
184 0.06
185 0.07
186 0.07
187 0.07
188 0.07
189 0.06
190 0.07
191 0.08
192 0.1
193 0.1
194 0.11
195 0.11
196 0.13
197 0.13
198 0.12
199 0.11
200 0.1
201 0.1
202 0.1
203 0.14
204 0.14
205 0.14
206 0.14
207 0.16
208 0.18
209 0.18
210 0.18
211 0.16
212 0.16
213 0.2
214 0.25
215 0.25
216 0.23
217 0.24
218 0.24
219 0.22
220 0.22
221 0.18
222 0.13
223 0.11
224 0.1
225 0.12
226 0.11
227 0.1
228 0.09
229 0.11
230 0.09
231 0.09
232 0.09
233 0.07
234 0.1
235 0.12
236 0.14
237 0.16
238 0.16
239 0.16
240 0.17
241 0.18
242 0.2
243 0.18
244 0.19
245 0.17
246 0.17
247 0.18
248 0.19
249 0.21
250 0.2
251 0.28
252 0.33
253 0.41
254 0.49
255 0.51
256 0.55
257 0.62
258 0.64
259 0.58
260 0.54
261 0.49
262 0.43
263 0.4
264 0.35
265 0.31
266 0.27
267 0.28
268 0.25
269 0.21
270 0.25
271 0.26
272 0.25
273 0.22
274 0.2
275 0.19
276 0.18
277 0.18
278 0.12
279 0.12
280 0.1
281 0.09
282 0.08
283 0.07
284 0.07
285 0.07
286 0.06
287 0.05
288 0.06
289 0.07
290 0.09
291 0.1
292 0.11
293 0.16
294 0.22
295 0.23
296 0.26
297 0.31
298 0.31
299 0.37
300 0.45
301 0.44
302 0.38
303 0.37
304 0.37
305 0.32
306 0.3
307 0.24
308 0.17
309 0.14
310 0.15
311 0.15
312 0.13
313 0.14
314 0.13
315 0.16
316 0.14
317 0.15
318 0.15
319 0.15
320 0.15
321 0.15
322 0.17
323 0.21
324 0.24
325 0.3
326 0.31
327 0.35
328 0.36
329 0.42
330 0.45
331 0.43
332 0.42
333 0.4
334 0.42
335 0.42
336 0.43
337 0.42
338 0.38
339 0.36
340 0.34
341 0.3
342 0.31
343 0.28
344 0.25
345 0.2
346 0.19
347 0.16
348 0.14
349 0.13
350 0.08
351 0.08
352 0.07
353 0.06
354 0.06
355 0.06
356 0.06
357 0.06
358 0.06
359 0.05
360 0.05
361 0.05
362 0.07
363 0.07
364 0.07
365 0.08
366 0.08
367 0.08
368 0.09
369 0.09
370 0.09
371 0.1
372 0.11
373 0.11
374 0.11
375 0.12
376 0.13
377 0.17
378 0.18
379 0.18
380 0.17
381 0.18
382 0.18
383 0.23
384 0.29
385 0.3
386 0.33
387 0.38
388 0.46
389 0.53
390 0.62
391 0.65
392 0.61
393 0.67
394 0.71
395 0.72
396 0.67
397 0.61
398 0.53
399 0.46
400 0.46
401 0.37
402 0.28
403 0.24
404 0.29
405 0.28
406 0.26
407 0.23
408 0.22
409 0.22
410 0.24
411 0.23
412 0.16
413 0.18
414 0.18
415 0.18
416 0.18
417 0.16
418 0.14
419 0.13
420 0.15
421 0.16
422 0.23
423 0.25
424 0.27
425 0.28
426 0.31
427 0.31
428 0.28
429 0.25
430 0.18
431 0.18
432 0.16
433 0.15
434 0.12
435 0.11
436 0.11
437 0.11
438 0.1
439 0.08
440 0.07
441 0.07
442 0.08
443 0.11
444 0.12
445 0.11
446 0.11
447 0.11
448 0.12
449 0.11
450 0.13
451 0.14
452 0.21
453 0.25
454 0.26
455 0.27
456 0.29
457 0.33
458 0.35
459 0.33
460 0.3
461 0.3
462 0.31
463 0.3
464 0.27
465 0.22
466 0.19
467 0.15
468 0.11
469 0.08
470 0.04
471 0.04
472 0.05
473 0.05
474 0.05
475 0.06
476 0.13
477 0.13
478 0.14
479 0.14
480 0.15
481 0.16
482 0.17
483 0.22
484 0.16
485 0.16
486 0.16
487 0.16
488 0.16
489 0.15
490 0.17
491 0.13
492 0.14
493 0.14
494 0.14
495 0.13
496 0.14
497 0.16
498 0.15
499 0.14
500 0.15
501 0.14
502 0.14
503 0.14
504 0.13
505 0.2
506 0.19
507 0.21
508 0.2
509 0.21
510 0.22
511 0.22
512 0.24
513 0.18
514 0.2
515 0.19
516 0.19
517 0.18
518 0.17
519 0.17
520 0.14
521 0.11
522 0.09
523 0.08
524 0.08
525 0.08
526 0.08
527 0.08