Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PAQ0

Protein Details
Accession A0A0C3PAQ0   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-29DDQVYRLPRQTHKNTRRSRLRAYKRAIGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_nucl 5.5, nucl 5, cyto 4, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MDDQVYRLPRQTHKNTRRSRLRAYKRAIGEFSSYHSFYLADSPGNLVGHLGVAARIASDTLIFFPGDTYHNCLGHDPGERSISEYVHQAIAAARVVPQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.85
4 0.89
5 0.85
6 0.86
7 0.85
8 0.86
9 0.85
10 0.82
11 0.79
12 0.74
13 0.71
14 0.62
15 0.53
16 0.45
17 0.36
18 0.33
19 0.29
20 0.25
21 0.2
22 0.19
23 0.17
24 0.14
25 0.16
26 0.12
27 0.08
28 0.08
29 0.09
30 0.1
31 0.1
32 0.09
33 0.06
34 0.05
35 0.05
36 0.05
37 0.04
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.07
53 0.09
54 0.1
55 0.15
56 0.17
57 0.18
58 0.19
59 0.19
60 0.2
61 0.21
62 0.25
63 0.21
64 0.2
65 0.22
66 0.21
67 0.24
68 0.24
69 0.22
70 0.18
71 0.18
72 0.17
73 0.16
74 0.16
75 0.13
76 0.12
77 0.13
78 0.13
79 0.11