Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3S522

Protein Details
Accession A0A0C3S522    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-43AEGGIVKKKKKSKSKSKDKDNEAEABasic
NLS Segment(s)
PositionSequence
21-37GGIVKKKKKSKSKSKDK
Subcellular Location(s) nucl 21.5, cyto_nucl 14.333, mito_nucl 11.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MSDYDFRPGGSLKLKGGVAEGGIVKKKKKSKSKSKDKDNEAEAQRLKELETVMREEERKTSPAGSSRASPAIVSSERKTAAEKRFEETQRKRLADKVAKLANKTHKDRVSEFNNKLEALSEHHDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.24
4 0.2
5 0.15
6 0.15
7 0.15
8 0.14
9 0.19
10 0.22
11 0.24
12 0.31
13 0.38
14 0.45
15 0.55
16 0.62
17 0.68
18 0.77
19 0.85
20 0.89
21 0.92
22 0.92
23 0.89
24 0.86
25 0.78
26 0.75
27 0.67
28 0.63
29 0.53
30 0.45
31 0.38
32 0.3
33 0.27
34 0.2
35 0.18
36 0.13
37 0.13
38 0.14
39 0.15
40 0.17
41 0.17
42 0.16
43 0.19
44 0.18
45 0.17
46 0.16
47 0.16
48 0.16
49 0.2
50 0.22
51 0.19
52 0.18
53 0.19
54 0.19
55 0.18
56 0.16
57 0.12
58 0.13
59 0.14
60 0.15
61 0.15
62 0.16
63 0.17
64 0.18
65 0.2
66 0.24
67 0.29
68 0.34
69 0.34
70 0.36
71 0.43
72 0.47
73 0.55
74 0.54
75 0.56
76 0.57
77 0.57
78 0.55
79 0.51
80 0.57
81 0.55
82 0.53
83 0.52
84 0.51
85 0.51
86 0.52
87 0.54
88 0.54
89 0.55
90 0.56
91 0.57
92 0.55
93 0.57
94 0.6
95 0.61
96 0.6
97 0.61
98 0.59
99 0.56
100 0.53
101 0.48
102 0.44
103 0.38
104 0.3
105 0.25
106 0.27
107 0.23
108 0.23
109 0.25
110 0.27
111 0.25