Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3RYY0

Protein Details
Accession A0A0C3RYY0    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-31ALPGNAVKKRPRRRYDEIERLYRHydrophilic
NLS Segment(s)
PositionSequence
18-18R
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences SGKTYSFVALPGNAVKKRPRRRYDEIERLYRCSFPSCTKAYGTLNHLNAHVTMQKHGSKRSPGEFKELRKQWRLQKKEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.44
4 0.54
5 0.63
6 0.66
7 0.68
8 0.75
9 0.82
10 0.84
11 0.85
12 0.81
13 0.79
14 0.73
15 0.68
16 0.6
17 0.51
18 0.41
19 0.34
20 0.3
21 0.24
22 0.27
23 0.25
24 0.26
25 0.25
26 0.27
27 0.25
28 0.25
29 0.27
30 0.28
31 0.28
32 0.26
33 0.26
34 0.23
35 0.22
36 0.21
37 0.18
38 0.13
39 0.13
40 0.16
41 0.21
42 0.23
43 0.28
44 0.31
45 0.35
46 0.39
47 0.46
48 0.51
49 0.48
50 0.54
51 0.56
52 0.58
53 0.62
54 0.64
55 0.63
56 0.62
57 0.67
58 0.68
59 0.73
60 0.74