Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PS44

Protein Details
Accession A0A0C3PS44   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20PPRPKPYRPDLPPAKRARVTBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002052  DNA_methylase_N6_adenine_CS  
IPR045123  METTL14-like  
IPR007757  MT-A70-like  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0008168  F:methyltransferase activity  
GO:0003676  F:nucleic acid binding  
GO:0043414  P:macromolecule methylation  
GO:0016070  P:RNA metabolic process  
Pfam View protein in Pfam  
PF05063  MT-A70  
PROSITE View protein in PROSITE  
PS51143  MT_A70  
PS00092  N6_MTASE  
PS51592  SAM_MTA70L_2  
Amino Acid Sequences PPRPKPYRPDLPPAKRARVTRYDNYVPEEETIRNDYSQRYVDGGEWPQDWVLGADPEHRFEEYPKQQRLLALKKASVAQHALAPRYLPFASLSSLNPSKFDVILIDPPFSSSFNWEDLQNLPIPTLAADPSYVLMWVGSGAGQGLERGREIMAKWGFRRCEDIVWVKTNKTTNQGPGTDPPTTSLLTRTKQHCLMGIRGTVRRSTDSWFVHCNVDTDVIIWEGDSSDPTLKPPEMYTLIENFCLGLRRLELFSRARTLRRGWVSALQDGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.76
3 0.75
4 0.73
5 0.71
6 0.7
7 0.69
8 0.69
9 0.67
10 0.64
11 0.65
12 0.58
13 0.49
14 0.43
15 0.38
16 0.3
17 0.26
18 0.28
19 0.24
20 0.23
21 0.23
22 0.23
23 0.25
24 0.26
25 0.24
26 0.21
27 0.21
28 0.21
29 0.24
30 0.25
31 0.23
32 0.21
33 0.21
34 0.19
35 0.18
36 0.17
37 0.12
38 0.11
39 0.09
40 0.09
41 0.15
42 0.16
43 0.18
44 0.19
45 0.19
46 0.19
47 0.2
48 0.3
49 0.34
50 0.42
51 0.43
52 0.43
53 0.44
54 0.48
55 0.53
56 0.5
57 0.49
58 0.43
59 0.4
60 0.4
61 0.43
62 0.39
63 0.34
64 0.28
65 0.2
66 0.21
67 0.22
68 0.22
69 0.18
70 0.18
71 0.15
72 0.17
73 0.16
74 0.13
75 0.12
76 0.12
77 0.13
78 0.14
79 0.14
80 0.17
81 0.2
82 0.19
83 0.19
84 0.19
85 0.19
86 0.17
87 0.16
88 0.12
89 0.1
90 0.16
91 0.16
92 0.16
93 0.14
94 0.15
95 0.16
96 0.15
97 0.14
98 0.11
99 0.11
100 0.13
101 0.14
102 0.13
103 0.14
104 0.14
105 0.15
106 0.14
107 0.12
108 0.1
109 0.09
110 0.09
111 0.08
112 0.08
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.03
123 0.03
124 0.03
125 0.03
126 0.02
127 0.02
128 0.03
129 0.03
130 0.03
131 0.04
132 0.04
133 0.04
134 0.05
135 0.05
136 0.06
137 0.06
138 0.14
139 0.16
140 0.19
141 0.21
142 0.25
143 0.27
144 0.26
145 0.31
146 0.25
147 0.24
148 0.25
149 0.3
150 0.28
151 0.33
152 0.33
153 0.28
154 0.31
155 0.33
156 0.3
157 0.29
158 0.28
159 0.29
160 0.32
161 0.33
162 0.32
163 0.33
164 0.35
165 0.31
166 0.28
167 0.24
168 0.21
169 0.2
170 0.19
171 0.2
172 0.21
173 0.23
174 0.3
175 0.31
176 0.34
177 0.37
178 0.37
179 0.37
180 0.35
181 0.36
182 0.33
183 0.33
184 0.32
185 0.32
186 0.33
187 0.3
188 0.29
189 0.28
190 0.25
191 0.26
192 0.3
193 0.3
194 0.32
195 0.34
196 0.33
197 0.33
198 0.32
199 0.3
200 0.23
201 0.22
202 0.18
203 0.15
204 0.14
205 0.12
206 0.11
207 0.1
208 0.08
209 0.06
210 0.07
211 0.07
212 0.08
213 0.1
214 0.1
215 0.12
216 0.16
217 0.16
218 0.17
219 0.18
220 0.22
221 0.22
222 0.25
223 0.26
224 0.28
225 0.28
226 0.27
227 0.26
228 0.21
229 0.19
230 0.19
231 0.17
232 0.14
233 0.15
234 0.17
235 0.19
236 0.21
237 0.26
238 0.27
239 0.3
240 0.36
241 0.38
242 0.39
243 0.42
244 0.44
245 0.48
246 0.5
247 0.49
248 0.45
249 0.49
250 0.49
251 0.49