FuNGI

A0A0C3PKI0

Protein Details

Accession

A0A0C3PKI0

Localization Confidence

High

Confidence Score

15.2

NoLS Segment(s)

Position	Sequence	Protein Nature
103-122	YGRAPRSSPKGKQNRSPQPA	Hydrophilic
396-418	TFATPSPASRRRNHRRVPSEGVF	Hydrophilic

NLS Segment(s)

Position	Sequence
132-191	PKKPKASKLQPASPSDKSSKPSAVQTPEKPPRGRQSAKQAFKAKADRSSPSDARSQARRP

Subcellular Location(s)

nucl 19, cyto_nucl 11.5, mito 6

Family & Domain DBs

Pfam	View protein in Pfam PF15365 PNRC

Amino Acid Sequences

MDLPTALQLASYPHRLPPAVRYVLRPPGFNHRLSRPLSSPTTTMLAVQKPVALFSSPSAHYRPSHSRHPSAPVLIRPTQTPGLLSLSKPVQPSPQRQQQAQQYGRAPRSSPKGKQNRSPQPAPAQALPVEDPKKPKASKLQPASPSDKSSKPSAVQTPEKPPRGRQSAKQAFKAKADRSSPSDARSQARRPSHQPSPPPPARTPEKGDSPAHVSVNPFRAQSFNHRDSDSNLFDPFVAHSTSDNESSESLPIATSNAGAKPLSLRAPQLAAHPTGKLAHRRQASQAQGSATPTHSVPVPRARHGRNQSKSAATAASATPQRRAPHASTTELPLAEWDDFPICDDLTVVSSPTTPVRESASFPKYSSATWQQSLLHEAPRTAPLSSTFDFPFAPTATFATPSPASRRRNHRRVPSEGVFAMSTDDDSSSDDSDELKNVMSKLALANRSVAPGLPRTPSPPVMDGMPPGFYAGSVFQNSPSPEELPVPAFRV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.28
2	0.3
3	0.31
4	0.34
5	0.39
6	0.42
7	0.42
8	0.45
9	0.48
10	0.57
11	0.57
12	0.52
13	0.46
14	0.49
15	0.52
16	0.52
17	0.51
18	0.47
19	0.53
20	0.54
21	0.57
22	0.49
23	0.51
24	0.5
25	0.47
26	0.42
27	0.37
28	0.37
29	0.3
30	0.3
31	0.29
32	0.27
33	0.26
34	0.25
35	0.24
36	0.21
37	0.22
38	0.2
39	0.16
40	0.14
41	0.14
42	0.2
43	0.19
44	0.22
45	0.24
46	0.26
47	0.27
48	0.33
49	0.41
50	0.4
51	0.49
52	0.54
53	0.58
54	0.58
55	0.63
56	0.61
57	0.58
58	0.57
59	0.52
60	0.51
61	0.5
62	0.47
63	0.41
64	0.41
65	0.37
66	0.32
67	0.27
68	0.22
69	0.24
70	0.24
71	0.23
72	0.23
73	0.23
74	0.26
75	0.26
76	0.26
77	0.29
78	0.35
79	0.43
80	0.48
81	0.55
82	0.57
83	0.58
84	0.64
85	0.64
86	0.68
87	0.62
88	0.59
89	0.56
90	0.59
91	0.61
92	0.55
93	0.48
94	0.43
95	0.49
96	0.51
97	0.52
98	0.55
99	0.62
100	0.67
101	0.74
102	0.79
103	0.8
104	0.8
105	0.77
106	0.72
107	0.69
108	0.69
109	0.63
110	0.54
111	0.46
112	0.38
113	0.36
114	0.32
115	0.3
116	0.27
117	0.26
118	0.29
119	0.3
120	0.37
121	0.36
122	0.4
123	0.44
124	0.51
125	0.58
126	0.62
127	0.67
128	0.65
129	0.7
130	0.71
131	0.63
132	0.59
133	0.53
134	0.48
135	0.43
136	0.4
137	0.38
138	0.34
139	0.36
140	0.38
141	0.41
142	0.44
143	0.46
144	0.52
145	0.57
146	0.62
147	0.58
148	0.57
149	0.59
150	0.61
151	0.61
152	0.57
153	0.6
154	0.63
155	0.67
156	0.69
157	0.67
158	0.6
159	0.63
160	0.64
161	0.55
162	0.52
163	0.5
164	0.45
165	0.44
166	0.49
167	0.44
168	0.38
169	0.4
170	0.36
171	0.37
172	0.4
173	0.41
174	0.41
175	0.45
176	0.48
177	0.48
178	0.52
179	0.56
180	0.56
181	0.58
182	0.57
183	0.61
184	0.61
185	0.61
186	0.55
187	0.54
188	0.53
189	0.5
190	0.5
191	0.44
192	0.44
193	0.44
194	0.43
195	0.38
196	0.38
197	0.36
198	0.3
199	0.26
200	0.22
201	0.21
202	0.24
203	0.23
204	0.18
205	0.16
206	0.16
207	0.17
208	0.25
209	0.31
210	0.31
211	0.32
212	0.33
213	0.33
214	0.35
215	0.4
216	0.32
217	0.25
218	0.21
219	0.19
220	0.18
221	0.17
222	0.15
223	0.1
224	0.08
225	0.07
226	0.07
227	0.1
228	0.11
229	0.12
230	0.12
231	0.11
232	0.11
233	0.11
234	0.11
235	0.08
236	0.07
237	0.06
238	0.06
239	0.06
240	0.05
241	0.05
242	0.06
243	0.06
244	0.07
245	0.07
246	0.07
247	0.07
248	0.09
249	0.11
250	0.11
251	0.12
252	0.11
253	0.13
254	0.14
255	0.16
256	0.16
257	0.15
258	0.15
259	0.15
260	0.14
261	0.16
262	0.18
263	0.23
264	0.24
265	0.29
266	0.3
267	0.32
268	0.36
269	0.41
270	0.41
271	0.36
272	0.36
273	0.3
274	0.29
275	0.29
276	0.26
277	0.19
278	0.16
279	0.13
280	0.12
281	0.12
282	0.12
283	0.14
284	0.21
285	0.24
286	0.28
287	0.35
288	0.38
289	0.45
290	0.54
291	0.61
292	0.57
293	0.59
294	0.58
295	0.52
296	0.5
297	0.42
298	0.33
299	0.23
300	0.2
301	0.15
302	0.16
303	0.18
304	0.18
305	0.19
306	0.23
307	0.24
308	0.25
309	0.3
310	0.28
311	0.32
312	0.35
313	0.36
314	0.33
315	0.36
316	0.35
317	0.3
318	0.27
319	0.19
320	0.17
321	0.15
322	0.13
323	0.1
324	0.09
325	0.09
326	0.1
327	0.1
328	0.08
329	0.07
330	0.08
331	0.07
332	0.08
333	0.08
334	0.08
335	0.07
336	0.07
337	0.08
338	0.1
339	0.12
340	0.1
341	0.12
342	0.16
343	0.17
344	0.2
345	0.27
346	0.31
347	0.3
348	0.3
349	0.33
350	0.29
351	0.28
352	0.31
353	0.32
354	0.32
355	0.31
356	0.33
357	0.32
358	0.32
359	0.37
360	0.32
361	0.28
362	0.24
363	0.23
364	0.23
365	0.25
366	0.25
367	0.2
368	0.19
369	0.17
370	0.23
371	0.23
372	0.25
373	0.22
374	0.22
375	0.21
376	0.21
377	0.21
378	0.16
379	0.15
380	0.13
381	0.14
382	0.14
383	0.16
384	0.15
385	0.17
386	0.17
387	0.19
388	0.27
389	0.33
390	0.39
391	0.46
392	0.57
393	0.63
394	0.72
395	0.79
396	0.81
397	0.81
398	0.83
399	0.84
400	0.77
401	0.72
402	0.62
403	0.55
404	0.44
405	0.36
406	0.3
407	0.2
408	0.16
409	0.11
410	0.11
411	0.09
412	0.11
413	0.12
414	0.11
415	0.12
416	0.11
417	0.13
418	0.13
419	0.14
420	0.13
421	0.13
422	0.14
423	0.14
424	0.15
425	0.13
426	0.13
427	0.17
428	0.23
429	0.25
430	0.23
431	0.26
432	0.26
433	0.28
434	0.27
435	0.23
436	0.19
437	0.21
438	0.24
439	0.23
440	0.24
441	0.27
442	0.32
443	0.35
444	0.36
445	0.34
446	0.32
447	0.32
448	0.32
449	0.31
450	0.27
451	0.24
452	0.2
453	0.19
454	0.17
455	0.13
456	0.13
457	0.13
458	0.15
459	0.17
460	0.17
461	0.18
462	0.24
463	0.25
464	0.27
465	0.27
466	0.24
467	0.23
468	0.26
469	0.27
470	0.25

A0A0C3PKI0

3D AlphaFold-predicted Structure Viewer