Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3SBD2

Protein Details
Accession A0A0C3SBD2    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-54TPSSSRKRSRENETDSQRNKREKAAERQRRKRERDRQAGLNNLLHydrophilic
NLS Segment(s)
PositionSequence
27-45QRNKREKAAERQRRKRERD
102-126RREKVRMAARERQRKHRALVKQKKL
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
Amino Acid Sequences MDGHVTPISATPSSSRKRSRENETDSQRNKREKAAERQRRKRERDRQAGLNNLLSMSQVQPSAPPPPEEPIAAPAEPTFDTTVLQQQQQKSGEDLSPDEAARREKVRMAARERQRKHRALVKQKKLRELGLDMGNELMPGMDEVQYRLGNDGQYQPIMHEIQQHPHAPHPHMHEPPFPQGQPLGGQTFASTLLLSFSCAPLLKAHLLRTLNMSNEELASLEPIIAQAWDHWDQQRRMHYAQHNAAAAAAASGPKPPEGTHVPDGHMSAREEHPMTFAPASTVH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.47
3 0.5
4 0.6
5 0.67
6 0.73
7 0.75
8 0.78
9 0.79
10 0.79
11 0.83
12 0.8
13 0.82
14 0.8
15 0.78
16 0.72
17 0.69
18 0.7
19 0.68
20 0.72
21 0.74
22 0.77
23 0.79
24 0.88
25 0.91
26 0.92
27 0.92
28 0.92
29 0.91
30 0.91
31 0.91
32 0.88
33 0.86
34 0.83
35 0.82
36 0.74
37 0.65
38 0.54
39 0.44
40 0.36
41 0.27
42 0.21
43 0.13
44 0.12
45 0.09
46 0.09
47 0.1
48 0.13
49 0.18
50 0.19
51 0.2
52 0.2
53 0.23
54 0.25
55 0.24
56 0.23
57 0.21
58 0.23
59 0.2
60 0.19
61 0.15
62 0.16
63 0.15
64 0.16
65 0.13
66 0.1
67 0.1
68 0.11
69 0.17
70 0.17
71 0.21
72 0.23
73 0.23
74 0.29
75 0.31
76 0.31
77 0.26
78 0.26
79 0.24
80 0.21
81 0.21
82 0.17
83 0.16
84 0.15
85 0.15
86 0.15
87 0.16
88 0.17
89 0.18
90 0.17
91 0.18
92 0.25
93 0.31
94 0.36
95 0.41
96 0.47
97 0.55
98 0.64
99 0.65
100 0.69
101 0.71
102 0.68
103 0.65
104 0.65
105 0.65
106 0.66
107 0.73
108 0.73
109 0.73
110 0.72
111 0.74
112 0.68
113 0.6
114 0.51
115 0.43
116 0.37
117 0.32
118 0.28
119 0.21
120 0.19
121 0.18
122 0.14
123 0.11
124 0.07
125 0.03
126 0.03
127 0.04
128 0.05
129 0.05
130 0.06
131 0.08
132 0.08
133 0.09
134 0.1
135 0.1
136 0.08
137 0.1
138 0.12
139 0.1
140 0.11
141 0.1
142 0.1
143 0.11
144 0.12
145 0.11
146 0.16
147 0.16
148 0.19
149 0.23
150 0.25
151 0.23
152 0.27
153 0.3
154 0.25
155 0.28
156 0.32
157 0.35
158 0.36
159 0.38
160 0.38
161 0.37
162 0.41
163 0.4
164 0.33
165 0.27
166 0.24
167 0.22
168 0.2
169 0.19
170 0.15
171 0.11
172 0.11
173 0.1
174 0.11
175 0.1
176 0.09
177 0.06
178 0.05
179 0.06
180 0.06
181 0.07
182 0.07
183 0.07
184 0.08
185 0.08
186 0.09
187 0.09
188 0.12
189 0.15
190 0.17
191 0.18
192 0.23
193 0.24
194 0.24
195 0.28
196 0.28
197 0.25
198 0.25
199 0.24
200 0.18
201 0.18
202 0.17
203 0.12
204 0.1
205 0.09
206 0.07
207 0.06
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.05
214 0.1
215 0.13
216 0.16
217 0.21
218 0.29
219 0.31
220 0.37
221 0.44
222 0.45
223 0.44
224 0.5
225 0.52
226 0.54
227 0.57
228 0.56
229 0.49
230 0.43
231 0.4
232 0.32
233 0.25
234 0.16
235 0.11
236 0.07
237 0.06
238 0.08
239 0.09
240 0.09
241 0.11
242 0.11
243 0.17
244 0.21
245 0.28
246 0.33
247 0.35
248 0.36
249 0.37
250 0.38
251 0.34
252 0.33
253 0.27
254 0.25
255 0.25
256 0.28
257 0.28
258 0.26
259 0.27
260 0.25
261 0.27
262 0.24
263 0.22