Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3NN71

Protein Details
Accession A0A0C3NN71    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-118VWAGVPGRQRKRKDGKQDKTLGGHydrophilic
NLS Segment(s)
PositionSequence
105-109RKRKD
Subcellular Location(s) mito 12, cyto 9, mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MPRVPHTPCETSPRLLPAKLRGQDLTLRHLVHDLPLPLRMGKWGRYSRLQPEVSGLDTRAYGTVMGATREGTEKEWQGKGIGKQQRSCICVGAMWVWAGVPGRQRKRKDGKQDKTLGGICRVRLSRVLAKIRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.41
4 0.4
5 0.46
6 0.46
7 0.47
8 0.4
9 0.39
10 0.43
11 0.41
12 0.39
13 0.34
14 0.31
15 0.27
16 0.28
17 0.25
18 0.21
19 0.22
20 0.18
21 0.15
22 0.16
23 0.17
24 0.16
25 0.16
26 0.19
27 0.18
28 0.2
29 0.28
30 0.31
31 0.33
32 0.38
33 0.42
34 0.43
35 0.49
36 0.45
37 0.37
38 0.35
39 0.33
40 0.3
41 0.26
42 0.21
43 0.13
44 0.12
45 0.12
46 0.09
47 0.08
48 0.06
49 0.05
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.08
57 0.09
58 0.08
59 0.1
60 0.12
61 0.15
62 0.16
63 0.16
64 0.17
65 0.2
66 0.21
67 0.27
68 0.31
69 0.32
70 0.34
71 0.41
72 0.44
73 0.43
74 0.41
75 0.33
76 0.27
77 0.24
78 0.22
79 0.16
80 0.12
81 0.1
82 0.09
83 0.07
84 0.08
85 0.08
86 0.09
87 0.15
88 0.23
89 0.33
90 0.41
91 0.46
92 0.55
93 0.65
94 0.73
95 0.78
96 0.8
97 0.8
98 0.83
99 0.87
100 0.79
101 0.74
102 0.7
103 0.62
104 0.58
105 0.52
106 0.43
107 0.42
108 0.41
109 0.36
110 0.35
111 0.39
112 0.39
113 0.44