Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3S158

Protein Details
Accession A0A0C3S158    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-51QSCLNCHTSKRKCDRKRPCQRCIQLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MTNFFTYGRPIADQLSLYSRRNRTTQSCLNCHTSKRKCDRKRPCQRCIQLGLTGLCVYEVDDPAARDDPNIDETTRLRNRIAELESLVRELRGAPHSHESLNCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.26
4 0.27
5 0.34
6 0.36
7 0.38
8 0.4
9 0.44
10 0.43
11 0.47
12 0.53
13 0.53
14 0.54
15 0.54
16 0.58
17 0.55
18 0.54
19 0.56
20 0.55
21 0.57
22 0.62
23 0.69
24 0.71
25 0.8
26 0.85
27 0.86
28 0.91
29 0.9
30 0.87
31 0.86
32 0.81
33 0.77
34 0.71
35 0.62
36 0.53
37 0.47
38 0.4
39 0.3
40 0.25
41 0.19
42 0.13
43 0.1
44 0.08
45 0.06
46 0.06
47 0.06
48 0.07
49 0.08
50 0.09
51 0.11
52 0.1
53 0.09
54 0.1
55 0.11
56 0.13
57 0.14
58 0.12
59 0.13
60 0.14
61 0.24
62 0.27
63 0.27
64 0.25
65 0.26
66 0.28
67 0.32
68 0.33
69 0.26
70 0.25
71 0.26
72 0.26
73 0.26
74 0.23
75 0.18
76 0.16
77 0.14
78 0.16
79 0.17
80 0.19
81 0.21
82 0.28
83 0.3
84 0.33