Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3SC90

Protein Details
Accession A0A0C3SC90    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPPRRRCAVCGSKQWRKEPSSHydrophilic
44-74ELGPHTMKKRALKSGRKKREWQSKADPKLYHBasic
562-583MERYEHRLVRWWRDERKAKESDBasic
NLS Segment(s)
PositionSequence
51-64KKRALKSGRKKREW
Subcellular Location(s) mito 10, nucl 8.5, cyto_nucl 6, plas 3, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033599  TAF1B/Rrn7  
Gene Ontology GO:0070860  C:RNA polymerase I core factor complex  
GO:0046872  F:metal ion binding  
GO:0001164  F:RNA polymerase I core promoter sequence-specific DNA binding  
Amino Acid Sequences MPPRRRCAVCGSKQWRKEPSSGLVTCGEGHVLQSYRNETSEVAELGPHTMKKRALKSGRKKREWQSKADPKLYHGERGRYHYYQCLQLLLRRQVAALIGAWALPAQFEAVCRDVWALHLSLLPSPPTAEPYFHATSQYGGRPPEAPGTPPSDGDPAEERGTGAERDVDDAESSAPSSSDEEDEEDPELEKLLRENSAPPSSSSSEDEEDGVQPRPPLHDKQRNPKTTFRPYDSPAGNIAVLMLACWTLRLPVMYMDFKRVIERHDLPYLDPIRFLPENMTLHLTKQTIKALSPQFPPTALHIHGLTSRLAKLIYRTYGILTPEHNAAPLLWRATRALQGTPTLYVLSKKLGRVLSLTLTLHYSLSPVLKRMKMRDPEHHKYDNAPPEVALITTVLVVLKLVYGLDGERRTPQSAEDPACALPNFTEYLAAVEAAGLGERNIEASLYDTAPEALDSVLELDGAAMDRYIDFCQKALLPLKDRRGNSDAPLGTRSQQQPMDAVPSETMKATPVREGSSDLRPGQAFRIYNSQDILGGLPTDYEKLVQRAARWAGVEEGYVLGAMERYEHRLVRWWRDERKAKESDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.76
4 0.73
5 0.69
6 0.66
7 0.66
8 0.59
9 0.54
10 0.47
11 0.43
12 0.37
13 0.31
14 0.24
15 0.14
16 0.14
17 0.16
18 0.15
19 0.16
20 0.2
21 0.24
22 0.24
23 0.25
24 0.26
25 0.21
26 0.24
27 0.25
28 0.22
29 0.18
30 0.16
31 0.16
32 0.18
33 0.21
34 0.21
35 0.19
36 0.24
37 0.29
38 0.36
39 0.43
40 0.51
41 0.58
42 0.66
43 0.75
44 0.81
45 0.86
46 0.87
47 0.89
48 0.89
49 0.9
50 0.85
51 0.83
52 0.83
53 0.82
54 0.83
55 0.82
56 0.72
57 0.65
58 0.69
59 0.62
60 0.6
61 0.55
62 0.53
63 0.5
64 0.56
65 0.6
66 0.53
67 0.52
68 0.51
69 0.49
70 0.47
71 0.43
72 0.41
73 0.35
74 0.37
75 0.43
76 0.41
77 0.41
78 0.35
79 0.34
80 0.3
81 0.29
82 0.26
83 0.17
84 0.12
85 0.09
86 0.09
87 0.08
88 0.07
89 0.06
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.09
96 0.11
97 0.11
98 0.11
99 0.12
100 0.11
101 0.12
102 0.14
103 0.11
104 0.11
105 0.12
106 0.12
107 0.13
108 0.15
109 0.14
110 0.12
111 0.13
112 0.13
113 0.16
114 0.17
115 0.16
116 0.17
117 0.23
118 0.26
119 0.24
120 0.26
121 0.21
122 0.22
123 0.25
124 0.27
125 0.23
126 0.21
127 0.22
128 0.22
129 0.23
130 0.27
131 0.24
132 0.22
133 0.22
134 0.27
135 0.26
136 0.26
137 0.26
138 0.22
139 0.21
140 0.22
141 0.22
142 0.19
143 0.2
144 0.19
145 0.17
146 0.16
147 0.18
148 0.15
149 0.12
150 0.12
151 0.1
152 0.13
153 0.13
154 0.13
155 0.11
156 0.11
157 0.11
158 0.09
159 0.09
160 0.07
161 0.06
162 0.06
163 0.08
164 0.08
165 0.09
166 0.09
167 0.12
168 0.12
169 0.13
170 0.13
171 0.12
172 0.12
173 0.11
174 0.11
175 0.08
176 0.08
177 0.08
178 0.09
179 0.09
180 0.1
181 0.13
182 0.18
183 0.21
184 0.21
185 0.21
186 0.25
187 0.25
188 0.27
189 0.26
190 0.23
191 0.22
192 0.21
193 0.21
194 0.17
195 0.16
196 0.16
197 0.15
198 0.13
199 0.12
200 0.12
201 0.16
202 0.19
203 0.24
204 0.33
205 0.42
206 0.47
207 0.58
208 0.68
209 0.72
210 0.73
211 0.75
212 0.73
213 0.73
214 0.73
215 0.67
216 0.62
217 0.56
218 0.6
219 0.52
220 0.45
221 0.36
222 0.31
223 0.25
224 0.19
225 0.16
226 0.09
227 0.07
228 0.06
229 0.04
230 0.03
231 0.03
232 0.03
233 0.03
234 0.04
235 0.04
236 0.04
237 0.05
238 0.07
239 0.1
240 0.13
241 0.14
242 0.17
243 0.18
244 0.18
245 0.2
246 0.19
247 0.18
248 0.22
249 0.24
250 0.24
251 0.27
252 0.27
253 0.25
254 0.31
255 0.31
256 0.24
257 0.21
258 0.18
259 0.19
260 0.18
261 0.18
262 0.13
263 0.16
264 0.17
265 0.17
266 0.2
267 0.16
268 0.16
269 0.19
270 0.18
271 0.14
272 0.16
273 0.17
274 0.15
275 0.15
276 0.21
277 0.22
278 0.25
279 0.26
280 0.27
281 0.24
282 0.24
283 0.25
284 0.2
285 0.2
286 0.17
287 0.15
288 0.13
289 0.13
290 0.14
291 0.14
292 0.13
293 0.11
294 0.1
295 0.09
296 0.09
297 0.09
298 0.1
299 0.12
300 0.13
301 0.13
302 0.13
303 0.14
304 0.16
305 0.17
306 0.16
307 0.13
308 0.13
309 0.14
310 0.14
311 0.12
312 0.1
313 0.09
314 0.1
315 0.1
316 0.1
317 0.09
318 0.1
319 0.11
320 0.12
321 0.16
322 0.15
323 0.15
324 0.14
325 0.15
326 0.15
327 0.15
328 0.14
329 0.11
330 0.1
331 0.1
332 0.1
333 0.12
334 0.14
335 0.14
336 0.18
337 0.18
338 0.19
339 0.19
340 0.2
341 0.18
342 0.18
343 0.18
344 0.14
345 0.14
346 0.14
347 0.12
348 0.1
349 0.09
350 0.07
351 0.1
352 0.1
353 0.13
354 0.17
355 0.21
356 0.24
357 0.29
358 0.36
359 0.42
360 0.47
361 0.54
362 0.59
363 0.63
364 0.67
365 0.66
366 0.58
367 0.53
368 0.56
369 0.54
370 0.46
371 0.38
372 0.31
373 0.29
374 0.28
375 0.24
376 0.16
377 0.08
378 0.06
379 0.06
380 0.06
381 0.04
382 0.04
383 0.04
384 0.04
385 0.03
386 0.03
387 0.03
388 0.03
389 0.03
390 0.04
391 0.09
392 0.1
393 0.11
394 0.15
395 0.17
396 0.19
397 0.19
398 0.21
399 0.22
400 0.28
401 0.29
402 0.26
403 0.26
404 0.24
405 0.26
406 0.24
407 0.18
408 0.12
409 0.11
410 0.11
411 0.09
412 0.1
413 0.08
414 0.09
415 0.09
416 0.09
417 0.07
418 0.06
419 0.06
420 0.05
421 0.05
422 0.03
423 0.03
424 0.03
425 0.03
426 0.04
427 0.04
428 0.04
429 0.04
430 0.07
431 0.09
432 0.09
433 0.09
434 0.09
435 0.09
436 0.09
437 0.09
438 0.07
439 0.05
440 0.05
441 0.05
442 0.06
443 0.05
444 0.05
445 0.05
446 0.04
447 0.05
448 0.05
449 0.05
450 0.04
451 0.04
452 0.04
453 0.06
454 0.08
455 0.11
456 0.11
457 0.11
458 0.13
459 0.14
460 0.19
461 0.25
462 0.29
463 0.33
464 0.4
465 0.5
466 0.54
467 0.54
468 0.56
469 0.54
470 0.51
471 0.47
472 0.49
473 0.41
474 0.37
475 0.38
476 0.33
477 0.3
478 0.35
479 0.34
480 0.32
481 0.32
482 0.3
483 0.3
484 0.3
485 0.34
486 0.27
487 0.26
488 0.2
489 0.2
490 0.2
491 0.19
492 0.17
493 0.14
494 0.16
495 0.16
496 0.19
497 0.2
498 0.22
499 0.22
500 0.27
501 0.29
502 0.32
503 0.37
504 0.33
505 0.34
506 0.33
507 0.33
508 0.32
509 0.34
510 0.29
511 0.26
512 0.35
513 0.33
514 0.35
515 0.35
516 0.31
517 0.26
518 0.25
519 0.23
520 0.14
521 0.12
522 0.1
523 0.09
524 0.09
525 0.1
526 0.1
527 0.11
528 0.13
529 0.15
530 0.21
531 0.22
532 0.24
533 0.31
534 0.34
535 0.35
536 0.32
537 0.31
538 0.29
539 0.28
540 0.26
541 0.18
542 0.16
543 0.12
544 0.11
545 0.1
546 0.06
547 0.06
548 0.06
549 0.08
550 0.09
551 0.15
552 0.19
553 0.21
554 0.22
555 0.31
556 0.39
557 0.46
558 0.54
559 0.58
560 0.63
561 0.73
562 0.81
563 0.79
564 0.81