Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3S8Y2

Protein Details
Accession A0A0C3S8Y2   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
33-58ILSCRRPRCRCARQFPPRHNRTRLRYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLAGRLELPCPAPHPRSYIRQDLACLHFTFTFILSCRRPRCRCARQFPPRHNRTRLRYNDRVNFMCECIGLSYSFMRYIRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.42
4 0.46
5 0.51
6 0.48
7 0.46
8 0.46
9 0.46
10 0.44
11 0.38
12 0.33
13 0.26
14 0.23
15 0.22
16 0.2
17 0.15
18 0.13
19 0.11
20 0.15
21 0.16
22 0.23
23 0.28
24 0.37
25 0.39
26 0.44
27 0.53
28 0.59
29 0.66
30 0.68
31 0.73
32 0.75
33 0.82
34 0.86
35 0.87
36 0.85
37 0.84
38 0.83
39 0.81
40 0.78
41 0.79
42 0.79
43 0.77
44 0.77
45 0.78
46 0.77
47 0.75
48 0.7
49 0.62
50 0.54
51 0.46
52 0.37
53 0.28
54 0.21
55 0.16
56 0.15
57 0.12
58 0.12
59 0.12
60 0.13
61 0.17