Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3S356

Protein Details
Accession A0A0C3S356    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKKPQSHHydrophilic
NLS Segment(s)
PositionSequence
15-24KAHRNGIKKP
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPQSHRTLSLRGVDPKFRRNARFALVGSQKARKDLKESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.79
7 0.83
8 0.81
9 0.77
10 0.75
11 0.74
12 0.71
13 0.65
14 0.62
15 0.57
16 0.54
17 0.5
18 0.48
19 0.42
20 0.42
21 0.41
22 0.42
23 0.39
24 0.4
25 0.45
26 0.46
27 0.47
28 0.44
29 0.46
30 0.43
31 0.45
32 0.4
33 0.41
34 0.4
35 0.42
36 0.42
37 0.45
38 0.42
39 0.43
40 0.46
41 0.4