Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3RXG6

Protein Details
Accession A0A0C3RXG6    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
221-241VYDIPPPRRRGPRRRAPSAPHBasic
489-511ERVARLVKTRRQLQNGKRRRAAAHydrophilic
NLS Segment(s)
PositionSequence
227-239PRRRGPRRRAPSA
551-556RKRQRH
Subcellular Location(s) mito 8, nucl 7, extr 6, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MALLLRICPGSITTVIPLQGHSTLRGRLLALSPQRPIMKALQVQQSLKSPFPILSSQPIYRTTYTHSMNMRVVGEPEVPSLPQSITGPAAELPHASPEPGLIPSYMPMMPSHESIAFAERRTLDTELPFSPHRQWQPVQDPRWPDSMSRVEDPWLSAHGTICHTAEAAQAAYSWPSSATPVAIPLPQDLAAQTTAASSAASLQSVGGPATFAAAQYAAAPVYDIPPPRRRGPRRRAPSAPHHSLPAAPGPSMRRDLVPLAPSPAAYSAHALGASSLPERAPPHAPSHTPRSSQPSTQVAPASAADLPAPPPQQTAQETAAAPAHNAAAGPSTSVAHAAEPEAAGRTLPAARFLDVGYCAYLKALCERVPCELNTDVCGLDGCTDVVPQAAIGSHVRDNHPHFTVRGSKHMCPRDHGGRRRGSTGIRGENFIRHLRDEWGTAARCILCKDGGVWLVRPEAAYIERHLKTCRAFPHKGRHALFPAAETDEERVARLVKTRRQLQNGKRRRAAAALEGADADADAAEHQEEHVDGGSEERDKNEDDDSVDSPRRKRQRHSRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.2
4 0.2
5 0.19
6 0.21
7 0.21
8 0.23
9 0.24
10 0.25
11 0.27
12 0.28
13 0.25
14 0.24
15 0.25
16 0.3
17 0.34
18 0.36
19 0.36
20 0.4
21 0.42
22 0.4
23 0.4
24 0.37
25 0.37
26 0.38
27 0.44
28 0.46
29 0.5
30 0.51
31 0.5
32 0.52
33 0.48
34 0.44
35 0.39
36 0.31
37 0.27
38 0.29
39 0.3
40 0.25
41 0.29
42 0.34
43 0.34
44 0.36
45 0.38
46 0.39
47 0.36
48 0.35
49 0.34
50 0.37
51 0.37
52 0.4
53 0.4
54 0.4
55 0.41
56 0.42
57 0.37
58 0.3
59 0.28
60 0.24
61 0.23
62 0.19
63 0.19
64 0.17
65 0.16
66 0.15
67 0.16
68 0.13
69 0.13
70 0.13
71 0.13
72 0.13
73 0.13
74 0.14
75 0.13
76 0.14
77 0.13
78 0.13
79 0.11
80 0.15
81 0.15
82 0.14
83 0.12
84 0.12
85 0.13
86 0.13
87 0.14
88 0.09
89 0.1
90 0.1
91 0.13
92 0.13
93 0.12
94 0.11
95 0.14
96 0.16
97 0.16
98 0.18
99 0.16
100 0.17
101 0.17
102 0.22
103 0.2
104 0.18
105 0.21
106 0.2
107 0.21
108 0.23
109 0.24
110 0.21
111 0.21
112 0.24
113 0.21
114 0.24
115 0.24
116 0.23
117 0.26
118 0.31
119 0.33
120 0.35
121 0.36
122 0.42
123 0.51
124 0.57
125 0.57
126 0.55
127 0.56
128 0.53
129 0.56
130 0.48
131 0.38
132 0.36
133 0.4
134 0.38
135 0.35
136 0.34
137 0.29
138 0.29
139 0.3
140 0.23
141 0.18
142 0.14
143 0.13
144 0.13
145 0.14
146 0.15
147 0.15
148 0.14
149 0.13
150 0.12
151 0.11
152 0.11
153 0.1
154 0.08
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.06
161 0.06
162 0.06
163 0.07
164 0.07
165 0.08
166 0.07
167 0.09
168 0.1
169 0.11
170 0.11
171 0.1
172 0.11
173 0.11
174 0.11
175 0.09
176 0.1
177 0.09
178 0.08
179 0.08
180 0.06
181 0.06
182 0.06
183 0.06
184 0.04
185 0.05
186 0.06
187 0.06
188 0.06
189 0.05
190 0.06
191 0.06
192 0.06
193 0.04
194 0.04
195 0.04
196 0.05
197 0.05
198 0.04
199 0.04
200 0.04
201 0.05
202 0.05
203 0.05
204 0.04
205 0.04
206 0.04
207 0.04
208 0.06
209 0.08
210 0.1
211 0.15
212 0.22
213 0.26
214 0.33
215 0.43
216 0.52
217 0.6
218 0.68
219 0.74
220 0.77
221 0.81
222 0.81
223 0.77
224 0.78
225 0.77
226 0.72
227 0.62
228 0.54
229 0.47
230 0.4
231 0.35
232 0.28
233 0.19
234 0.13
235 0.14
236 0.15
237 0.17
238 0.18
239 0.18
240 0.14
241 0.15
242 0.17
243 0.17
244 0.18
245 0.16
246 0.16
247 0.15
248 0.15
249 0.14
250 0.13
251 0.11
252 0.09
253 0.1
254 0.08
255 0.08
256 0.08
257 0.07
258 0.07
259 0.06
260 0.06
261 0.05
262 0.05
263 0.05
264 0.07
265 0.08
266 0.1
267 0.13
268 0.14
269 0.18
270 0.2
271 0.23
272 0.24
273 0.32
274 0.33
275 0.32
276 0.32
277 0.36
278 0.36
279 0.35
280 0.37
281 0.33
282 0.31
283 0.31
284 0.29
285 0.22
286 0.2
287 0.19
288 0.15
289 0.1
290 0.09
291 0.07
292 0.07
293 0.08
294 0.1
295 0.11
296 0.1
297 0.11
298 0.11
299 0.15
300 0.16
301 0.18
302 0.17
303 0.19
304 0.19
305 0.19
306 0.2
307 0.16
308 0.15
309 0.11
310 0.09
311 0.07
312 0.07
313 0.06
314 0.05
315 0.05
316 0.05
317 0.05
318 0.05
319 0.05
320 0.06
321 0.06
322 0.05
323 0.06
324 0.06
325 0.06
326 0.06
327 0.06
328 0.06
329 0.06
330 0.06
331 0.05
332 0.06
333 0.07
334 0.08
335 0.11
336 0.11
337 0.12
338 0.13
339 0.13
340 0.13
341 0.12
342 0.12
343 0.09
344 0.09
345 0.08
346 0.08
347 0.08
348 0.07
349 0.09
350 0.12
351 0.13
352 0.15
353 0.16
354 0.2
355 0.22
356 0.21
357 0.22
358 0.22
359 0.21
360 0.2
361 0.2
362 0.16
363 0.14
364 0.14
365 0.1
366 0.08
367 0.08
368 0.07
369 0.06
370 0.06
371 0.06
372 0.06
373 0.05
374 0.04
375 0.04
376 0.04
377 0.05
378 0.06
379 0.09
380 0.11
381 0.14
382 0.15
383 0.2
384 0.24
385 0.27
386 0.29
387 0.28
388 0.26
389 0.29
390 0.36
391 0.34
392 0.39
393 0.4
394 0.42
395 0.5
396 0.57
397 0.54
398 0.5
399 0.55
400 0.56
401 0.61
402 0.64
403 0.64
404 0.64
405 0.65
406 0.64
407 0.6
408 0.51
409 0.49
410 0.49
411 0.49
412 0.42
413 0.42
414 0.4
415 0.4
416 0.42
417 0.39
418 0.33
419 0.26
420 0.27
421 0.27
422 0.28
423 0.26
424 0.25
425 0.27
426 0.26
427 0.24
428 0.25
429 0.23
430 0.22
431 0.22
432 0.21
433 0.15
434 0.14
435 0.15
436 0.16
437 0.18
438 0.19
439 0.19
440 0.19
441 0.19
442 0.19
443 0.19
444 0.15
445 0.14
446 0.14
447 0.15
448 0.16
449 0.23
450 0.25
451 0.27
452 0.29
453 0.31
454 0.32
455 0.37
456 0.43
457 0.43
458 0.49
459 0.55
460 0.64
461 0.68
462 0.75
463 0.71
464 0.69
465 0.65
466 0.62
467 0.55
468 0.45
469 0.39
470 0.31
471 0.29
472 0.23
473 0.21
474 0.2
475 0.19
476 0.18
477 0.17
478 0.16
479 0.17
480 0.24
481 0.3
482 0.33
483 0.42
484 0.51
485 0.58
486 0.66
487 0.75
488 0.78
489 0.81
490 0.84
491 0.85
492 0.82
493 0.77
494 0.71
495 0.66
496 0.59
497 0.55
498 0.53
499 0.44
500 0.38
501 0.35
502 0.32
503 0.26
504 0.21
505 0.14
506 0.06
507 0.04
508 0.04
509 0.04
510 0.05
511 0.05
512 0.05
513 0.07
514 0.07
515 0.08
516 0.09
517 0.09
518 0.08
519 0.1
520 0.13
521 0.16
522 0.16
523 0.17
524 0.19
525 0.2
526 0.22
527 0.22
528 0.21
529 0.2
530 0.23
531 0.24
532 0.28
533 0.33
534 0.37
535 0.4
536 0.48
537 0.56
538 0.6
539 0.68