Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3PKU2

Protein Details
Accession A0A0C3PKU2   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
289-315HERPVPKERERDRRAHRERNQDRERDRBasic
NLS Segment(s)
PositionSequence
270-351EPDRDRERERDRAPVSNRHHERPVPKERERDRRAHRERNQDRERDRGRARDSDRSSKRNGAYGGGNQSGGGGGGGGGRRPRR
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033757  WTAP  
Gene Ontology GO:0005634  C:nucleus  
GO:0080009  P:mRNA methylation  
GO:0006397  P:mRNA processing  
GO:0000381  P:regulation of alternative mRNA splicing, via spliceosome  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF17098  Wtap  
Amino Acid Sequences MDLPTPRELELETLLRQRDAQLADLTDEVVHLRQYLSNQPAPVVTDPISLPPPLVSLLLPHINDRSDATSPSSSSTVTAALTQRVKVLQEENDELYEILKTGETGRLKEDVRSLRRVVQKLEGALRDSHQVITSLSDELDKAQTTIVANGRTSSQATNPRTASQSPLSRVNRSLPPHMSQPTNGKLPPTGPRAHKKPRLSETPSLPPTHSNQQTTNNRSQSSSVRRQDSAERSPRVPDRKTKMETDDDDRGHWSPDRSRDYDRERDKDREPDRDRERERDRAPVSNRHHERPVPKERERDRRAHRERNQDRERDRGRARDSDRSSKRNGAYGGGNQSGGGGGGGGGRRPRRGSNANSYTSGGDRTLRERMGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.28
4 0.27
5 0.28
6 0.26
7 0.26
8 0.24
9 0.24
10 0.24
11 0.24
12 0.23
13 0.16
14 0.15
15 0.13
16 0.1
17 0.09
18 0.09
19 0.09
20 0.11
21 0.14
22 0.22
23 0.27
24 0.3
25 0.3
26 0.3
27 0.3
28 0.32
29 0.3
30 0.26
31 0.2
32 0.19
33 0.19
34 0.21
35 0.22
36 0.18
37 0.17
38 0.14
39 0.14
40 0.12
41 0.13
42 0.09
43 0.09
44 0.14
45 0.18
46 0.18
47 0.19
48 0.2
49 0.2
50 0.21
51 0.21
52 0.21
53 0.18
54 0.19
55 0.22
56 0.22
57 0.22
58 0.24
59 0.22
60 0.18
61 0.17
62 0.17
63 0.13
64 0.12
65 0.15
66 0.14
67 0.18
68 0.19
69 0.19
70 0.2
71 0.2
72 0.21
73 0.2
74 0.22
75 0.21
76 0.24
77 0.26
78 0.26
79 0.25
80 0.25
81 0.22
82 0.18
83 0.14
84 0.1
85 0.07
86 0.06
87 0.06
88 0.07
89 0.13
90 0.14
91 0.15
92 0.17
93 0.21
94 0.22
95 0.23
96 0.29
97 0.32
98 0.35
99 0.39
100 0.39
101 0.42
102 0.48
103 0.49
104 0.45
105 0.42
106 0.4
107 0.38
108 0.4
109 0.34
110 0.29
111 0.28
112 0.26
113 0.22
114 0.21
115 0.18
116 0.14
117 0.13
118 0.11
119 0.12
120 0.12
121 0.1
122 0.09
123 0.09
124 0.09
125 0.09
126 0.1
127 0.08
128 0.08
129 0.07
130 0.08
131 0.08
132 0.12
133 0.14
134 0.13
135 0.13
136 0.14
137 0.14
138 0.14
139 0.15
140 0.12
141 0.15
142 0.22
143 0.25
144 0.29
145 0.29
146 0.3
147 0.32
148 0.31
149 0.3
150 0.26
151 0.28
152 0.26
153 0.34
154 0.35
155 0.35
156 0.36
157 0.36
158 0.37
159 0.35
160 0.38
161 0.31
162 0.31
163 0.34
164 0.35
165 0.31
166 0.28
167 0.3
168 0.28
169 0.28
170 0.26
171 0.22
172 0.2
173 0.21
174 0.25
175 0.24
176 0.26
177 0.28
178 0.36
179 0.43
180 0.52
181 0.58
182 0.58
183 0.61
184 0.63
185 0.66
186 0.65
187 0.63
188 0.59
189 0.59
190 0.57
191 0.5
192 0.44
193 0.37
194 0.34
195 0.37
196 0.36
197 0.3
198 0.3
199 0.39
200 0.46
201 0.5
202 0.54
203 0.49
204 0.46
205 0.44
206 0.44
207 0.42
208 0.42
209 0.46
210 0.44
211 0.44
212 0.45
213 0.46
214 0.51
215 0.5
216 0.5
217 0.49
218 0.46
219 0.43
220 0.47
221 0.52
222 0.51
223 0.49
224 0.49
225 0.48
226 0.54
227 0.56
228 0.56
229 0.54
230 0.54
231 0.53
232 0.5
233 0.5
234 0.42
235 0.39
236 0.37
237 0.33
238 0.28
239 0.27
240 0.24
241 0.22
242 0.3
243 0.35
244 0.36
245 0.41
246 0.47
247 0.52
248 0.58
249 0.61
250 0.59
251 0.59
252 0.61
253 0.6
254 0.62
255 0.61
256 0.62
257 0.59
258 0.62
259 0.64
260 0.69
261 0.69
262 0.68
263 0.69
264 0.68
265 0.65
266 0.64
267 0.6
268 0.58
269 0.59
270 0.6
271 0.61
272 0.62
273 0.65
274 0.6
275 0.63
276 0.6
277 0.62
278 0.62
279 0.65
280 0.64
281 0.65
282 0.71
283 0.74
284 0.79
285 0.78
286 0.78
287 0.77
288 0.79
289 0.83
290 0.84
291 0.83
292 0.83
293 0.86
294 0.87
295 0.86
296 0.84
297 0.78
298 0.78
299 0.74
300 0.72
301 0.69
302 0.67
303 0.64
304 0.64
305 0.66
306 0.65
307 0.68
308 0.69
309 0.72
310 0.69
311 0.69
312 0.68
313 0.64
314 0.6
315 0.54
316 0.47
317 0.44
318 0.44
319 0.45
320 0.38
321 0.35
322 0.29
323 0.27
324 0.23
325 0.18
326 0.12
327 0.05
328 0.04
329 0.07
330 0.08
331 0.1
332 0.16
333 0.2
334 0.25
335 0.29
336 0.34
337 0.4
338 0.48
339 0.54
340 0.59
341 0.64
342 0.64
343 0.63
344 0.59
345 0.53
346 0.46
347 0.4
348 0.3
349 0.26
350 0.25
351 0.27
352 0.31