Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FSQ0

Protein Details
Accession Q6FSQ0    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-84EKDVYLEKRKEKRARKSTLRKRREEEFBasic
144-172LNDTKESSKRRSSKKKNKNKGFKQTLSSSHydrophilic
NLS Segment(s)
PositionSequence
65-80KRKEKRARKSTLRKRR
151-164SKRRSSKKKNKNKG
Subcellular Location(s) nucl 16.5, mito_nucl 13.5, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031404  Rrt14  
Gene Ontology GO:0005730  C:nucleolus  
KEGG cgr:CAGL0G08778g  -  
Pfam View protein in Pfam  
PF17075  RRT14  
Amino Acid Sequences MVSKNSKMQATLAVNSVLASLLPGAAAITGSNKKVSKPRVAKAQLIDMNLKKRLELQEKDVYLEKRKEKRARKSTLRKRREEEFEMEQKAKLQILNKHREQGTLTQKEKAYLDELAKRNTKKLKSWDLEDDVKEDFLEIQAQILNDTKESSKRRSSKKKNKNKGFKQTLSSSSKVQDHRYPGLTPGLAPVGLSDEEESSDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.23
4 0.14
5 0.09
6 0.07
7 0.05
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.08
16 0.11
17 0.12
18 0.18
19 0.18
20 0.22
21 0.3
22 0.36
23 0.43
24 0.48
25 0.54
26 0.59
27 0.63
28 0.65
29 0.6
30 0.63
31 0.55
32 0.5
33 0.49
34 0.43
35 0.43
36 0.43
37 0.4
38 0.3
39 0.32
40 0.38
41 0.4
42 0.39
43 0.41
44 0.44
45 0.44
46 0.46
47 0.46
48 0.41
49 0.39
50 0.43
51 0.45
52 0.45
53 0.54
54 0.62
55 0.66
56 0.75
57 0.78
58 0.81
59 0.84
60 0.87
61 0.89
62 0.9
63 0.9
64 0.86
65 0.81
66 0.78
67 0.75
68 0.68
69 0.62
70 0.58
71 0.54
72 0.5
73 0.47
74 0.39
75 0.33
76 0.29
77 0.24
78 0.19
79 0.17
80 0.21
81 0.29
82 0.36
83 0.36
84 0.4
85 0.39
86 0.39
87 0.36
88 0.37
89 0.38
90 0.39
91 0.39
92 0.38
93 0.38
94 0.39
95 0.37
96 0.3
97 0.22
98 0.17
99 0.18
100 0.22
101 0.24
102 0.27
103 0.32
104 0.31
105 0.35
106 0.39
107 0.4
108 0.39
109 0.45
110 0.51
111 0.49
112 0.53
113 0.54
114 0.52
115 0.52
116 0.46
117 0.4
118 0.3
119 0.27
120 0.22
121 0.16
122 0.11
123 0.07
124 0.08
125 0.06
126 0.06
127 0.07
128 0.07
129 0.08
130 0.1
131 0.1
132 0.09
133 0.1
134 0.12
135 0.18
136 0.22
137 0.28
138 0.35
139 0.44
140 0.54
141 0.64
142 0.74
143 0.78
144 0.85
145 0.9
146 0.92
147 0.95
148 0.95
149 0.95
150 0.95
151 0.93
152 0.88
153 0.83
154 0.78
155 0.76
156 0.71
157 0.63
158 0.54
159 0.49
160 0.5
161 0.47
162 0.47
163 0.45
164 0.45
165 0.48
166 0.48
167 0.45
168 0.41
169 0.42
170 0.36
171 0.3
172 0.26
173 0.22
174 0.19
175 0.17
176 0.15
177 0.13
178 0.13
179 0.13
180 0.12
181 0.1
182 0.12