Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3S5E1

Protein Details
Accession A0A0C3S5E1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-61GPAGTKKPRRHNEHSLVGRRBasic
NLS Segment(s)
PositionSequence
47-53KKPRRHN
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MSPHGPARLALLPTSVVHRLPPARSTVCTGMQRDVNPLRHLGPAGTKKPRRHNEHSLVGRRPKGASLLSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.14
4 0.14
5 0.18
6 0.2
7 0.21
8 0.22
9 0.24
10 0.24
11 0.25
12 0.29
13 0.28
14 0.3
15 0.32
16 0.31
17 0.29
18 0.29
19 0.28
20 0.3
21 0.31
22 0.28
23 0.25
24 0.25
25 0.24
26 0.22
27 0.22
28 0.17
29 0.19
30 0.22
31 0.28
32 0.37
33 0.42
34 0.49
35 0.59
36 0.68
37 0.71
38 0.73
39 0.77
40 0.75
41 0.79
42 0.81
43 0.79
44 0.78
45 0.76
46 0.71
47 0.63
48 0.55
49 0.47
50 0.42
51 0.36