Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3S7G8

Protein Details
Accession A0A0C3S7G8   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
104-139AAPWFGCRSPRRRPRTCRPPRKHQRQRNPRTVALCIHydrophilic
NLS Segment(s)
PositionSequence
113-129PRRRPRTCRPPRKHQRQ
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001086  Preph_deHydtase  
Gene Ontology GO:0004664  F:prephenate dehydratase activity  
GO:0009094  P:L-phenylalanine biosynthetic process  
Pfam View protein in Pfam  
PF00800  PDT  
Amino Acid Sequences MAKHFPNVTLEKKTSTAAAARSLFDDDDLGMRSAAICSTICEKVIDGLEILQRSVQDSKSESTPHCRPRLYVNGCSQLITPVSTSSHMDSTPGCPWSTSDPSFAAPWFGCRSPRRRPRTCRPPRKHQRQRNPRTVALCIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.28
4 0.22
5 0.27
6 0.26
7 0.25
8 0.25
9 0.25
10 0.23
11 0.19
12 0.17
13 0.11
14 0.11
15 0.12
16 0.11
17 0.09
18 0.09
19 0.09
20 0.09
21 0.08
22 0.08
23 0.06
24 0.07
25 0.11
26 0.12
27 0.12
28 0.12
29 0.12
30 0.13
31 0.14
32 0.13
33 0.09
34 0.1
35 0.11
36 0.11
37 0.11
38 0.09
39 0.09
40 0.1
41 0.12
42 0.11
43 0.11
44 0.13
45 0.14
46 0.16
47 0.19
48 0.18
49 0.23
50 0.29
51 0.34
52 0.37
53 0.35
54 0.34
55 0.38
56 0.47
57 0.45
58 0.44
59 0.41
60 0.43
61 0.43
62 0.42
63 0.36
64 0.27
65 0.22
66 0.17
67 0.13
68 0.08
69 0.09
70 0.09
71 0.11
72 0.11
73 0.11
74 0.11
75 0.11
76 0.11
77 0.13
78 0.15
79 0.16
80 0.14
81 0.13
82 0.15
83 0.2
84 0.25
85 0.23
86 0.23
87 0.23
88 0.24
89 0.25
90 0.23
91 0.2
92 0.14
93 0.17
94 0.18
95 0.19
96 0.25
97 0.3
98 0.37
99 0.45
100 0.55
101 0.62
102 0.68
103 0.76
104 0.81
105 0.86
106 0.9
107 0.91
108 0.9
109 0.91
110 0.93
111 0.95
112 0.94
113 0.94
114 0.94
115 0.94
116 0.96
117 0.95
118 0.91
119 0.87
120 0.8