Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3RQG8

Protein Details
Accession A0A0C3RQG8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
81-107SVQSLICRASRKKKHEKVGNRARWWRRHydrophilic
NLS Segment(s)
PositionSequence
90-107SRKKKHEKVGNRARWWRR
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MAGANRTHACTSRAPSSSRVTLPRAGPSAPDDPRRERLDARPLASTPGRLGRRQVLASTSSSRVHQTPPVRPSFRRSSAISVQSLICRASRKKKHEKVGNRARWWRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.43
4 0.45
5 0.44
6 0.44
7 0.39
8 0.41
9 0.41
10 0.41
11 0.37
12 0.32
13 0.29
14 0.29
15 0.32
16 0.31
17 0.36
18 0.35
19 0.38
20 0.44
21 0.47
22 0.45
23 0.42
24 0.44
25 0.47
26 0.46
27 0.43
28 0.39
29 0.36
30 0.37
31 0.33
32 0.28
33 0.19
34 0.23
35 0.23
36 0.22
37 0.24
38 0.24
39 0.26
40 0.26
41 0.25
42 0.19
43 0.18
44 0.2
45 0.2
46 0.19
47 0.17
48 0.17
49 0.18
50 0.18
51 0.18
52 0.22
53 0.25
54 0.3
55 0.35
56 0.42
57 0.45
58 0.45
59 0.5
60 0.52
61 0.52
62 0.49
63 0.46
64 0.45
65 0.48
66 0.51
67 0.45
68 0.38
69 0.34
70 0.31
71 0.3
72 0.24
73 0.19
74 0.2
75 0.26
76 0.35
77 0.44
78 0.53
79 0.63
80 0.71
81 0.8
82 0.85
83 0.88
84 0.89
85 0.9
86 0.91
87 0.89