Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HU24

Protein Details
Accession A0A0L0HU24   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MTRYRRTKTHRGIRDIKRAKRTRARTKDLDQBasic
NLS Segment(s)
PositionSequence
6-25RTKTHRGIRDIKRAKRTRAR
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MTRYRRTKTHRGIRDIKRAKRTRARTKDLDQIHEDMKTPEKFEQQAVDADLPGLGQHYCIQCSRYFTDAGALSDHYKTKLHKKRLKVLKESPYTQKEAEAAAGLFTDNGKGRVSGVDDATATGLMDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.84
4 0.84
5 0.83
6 0.83
7 0.83
8 0.84
9 0.85
10 0.85
11 0.85
12 0.82
13 0.8
14 0.79
15 0.73
16 0.68
17 0.6
18 0.52
19 0.45
20 0.38
21 0.33
22 0.26
23 0.28
24 0.23
25 0.22
26 0.22
27 0.24
28 0.25
29 0.25
30 0.25
31 0.2
32 0.21
33 0.2
34 0.18
35 0.14
36 0.13
37 0.11
38 0.09
39 0.07
40 0.06
41 0.04
42 0.04
43 0.07
44 0.08
45 0.09
46 0.1
47 0.12
48 0.12
49 0.16
50 0.17
51 0.16
52 0.16
53 0.14
54 0.17
55 0.17
56 0.16
57 0.13
58 0.12
59 0.12
60 0.13
61 0.14
62 0.11
63 0.12
64 0.15
65 0.25
66 0.33
67 0.43
68 0.48
69 0.55
70 0.64
71 0.72
72 0.78
73 0.76
74 0.76
75 0.75
76 0.75
77 0.72
78 0.71
79 0.65
80 0.6
81 0.51
82 0.44
83 0.35
84 0.29
85 0.25
86 0.18
87 0.14
88 0.1
89 0.1
90 0.08
91 0.07
92 0.07
93 0.09
94 0.09
95 0.1
96 0.11
97 0.11
98 0.12
99 0.14
100 0.17
101 0.18
102 0.18
103 0.18
104 0.18
105 0.18
106 0.18
107 0.16