Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HND2

Protein Details
Accession A0A0L0HND2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
81-125KPTATRSRKPTHKATHKPTHKATHKPTHKATHKPTRTRKASKPTNBasic
NLS Segment(s)
PositionSequence
85-123TRSRKPTHKATHKPTHKATHKPTHKATHKPTRTRKASKP
Subcellular Location(s) extr 15, cyto 4, E.R. 4, nucl 1, mito 1, pero 1, vacu 1, mito_nucl 1
Family & Domain DBs
Amino Acid Sequences MHAFTTLLVALAAIALLISGSNAVKAGGKCTPSKDTYACKGKDFLQCNAATGNWTVQNTCQEPCANVPQYAAFCNVTKSLKPTATRSRKPTHKATHKPTHKATHKPTHKATHKPTRTRKASKPTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.03
8 0.04
9 0.04
10 0.05
11 0.09
12 0.1
13 0.13
14 0.15
15 0.18
16 0.2
17 0.24
18 0.29
19 0.27
20 0.31
21 0.32
22 0.34
23 0.4
24 0.47
25 0.45
26 0.41
27 0.41
28 0.43
29 0.47
30 0.45
31 0.38
32 0.36
33 0.34
34 0.33
35 0.31
36 0.25
37 0.19
38 0.15
39 0.15
40 0.11
41 0.11
42 0.1
43 0.11
44 0.15
45 0.15
46 0.15
47 0.15
48 0.13
49 0.14
50 0.16
51 0.21
52 0.18
53 0.17
54 0.17
55 0.17
56 0.17
57 0.17
58 0.17
59 0.12
60 0.11
61 0.12
62 0.14
63 0.14
64 0.14
65 0.17
66 0.19
67 0.23
68 0.25
69 0.31
70 0.39
71 0.48
72 0.54
73 0.58
74 0.63
75 0.68
76 0.71
77 0.74
78 0.74
79 0.75
80 0.78
81 0.81
82 0.83
83 0.83
84 0.84
85 0.82
86 0.82
87 0.78
88 0.78
89 0.78
90 0.78
91 0.78
92 0.78
93 0.78
94 0.78
95 0.78
96 0.78
97 0.79
98 0.79
99 0.8
100 0.83
101 0.86
102 0.87
103 0.89
104 0.88
105 0.88