Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FN00

Protein Details
Accession Q6FN00   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
178-204AEKVRKQLSKLAKQKKKKETEEEFYNNHydrophilic
NLS Segment(s)
PositionSequence
183-195KQLSKLAKQKKKK
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039730  Jlp2/Ccd25  
IPR008532  NFACT_RNA-bd  
KEGG cgr:CAGL0K03883g  -  
Pfam View protein in Pfam  
PF05670  NFACT-R_1  
Amino Acid Sequences MVYFYESQPELGYDGYQVIIGKDKFENDLLIKYGYRELNYMWFHTDKYSSGHVYLKMKESEKSLGDVPKAVVEDCLQLCKSESIQGNKMPECTIIYTPWHNLRKNRYMKPGEVSFKSVKNCKKTVCYNRDNKILNRLSKTRVEIYDDVEKLLHEAKKSKDPNYFTDYISRNRDSLVEAEKVRKQLSKLAKQKKKKETEEEFYNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.09
5 0.09
6 0.15
7 0.15
8 0.17
9 0.18
10 0.19
11 0.2
12 0.21
13 0.24
14 0.18
15 0.21
16 0.2
17 0.21
18 0.2
19 0.19
20 0.23
21 0.22
22 0.21
23 0.19
24 0.19
25 0.25
26 0.26
27 0.26
28 0.25
29 0.23
30 0.23
31 0.24
32 0.24
33 0.18
34 0.19
35 0.22
36 0.19
37 0.21
38 0.23
39 0.26
40 0.28
41 0.29
42 0.31
43 0.31
44 0.31
45 0.3
46 0.3
47 0.3
48 0.27
49 0.27
50 0.26
51 0.24
52 0.23
53 0.23
54 0.2
55 0.18
56 0.17
57 0.15
58 0.12
59 0.1
60 0.13
61 0.12
62 0.14
63 0.12
64 0.12
65 0.13
66 0.13
67 0.13
68 0.15
69 0.19
70 0.21
71 0.24
72 0.27
73 0.29
74 0.29
75 0.29
76 0.24
77 0.2
78 0.17
79 0.16
80 0.14
81 0.12
82 0.13
83 0.14
84 0.16
85 0.23
86 0.28
87 0.28
88 0.32
89 0.38
90 0.46
91 0.52
92 0.55
93 0.57
94 0.55
95 0.54
96 0.54
97 0.53
98 0.48
99 0.41
100 0.41
101 0.34
102 0.34
103 0.36
104 0.37
105 0.37
106 0.38
107 0.41
108 0.39
109 0.43
110 0.49
111 0.57
112 0.59
113 0.63
114 0.65
115 0.67
116 0.72
117 0.7
118 0.61
119 0.61
120 0.58
121 0.54
122 0.51
123 0.49
124 0.45
125 0.45
126 0.47
127 0.42
128 0.37
129 0.38
130 0.34
131 0.35
132 0.38
133 0.34
134 0.31
135 0.26
136 0.24
137 0.19
138 0.24
139 0.21
140 0.15
141 0.21
142 0.24
143 0.34
144 0.39
145 0.43
146 0.46
147 0.48
148 0.52
149 0.54
150 0.53
151 0.44
152 0.48
153 0.46
154 0.44
155 0.47
156 0.43
157 0.36
158 0.34
159 0.34
160 0.28
161 0.28
162 0.26
163 0.25
164 0.25
165 0.3
166 0.33
167 0.36
168 0.37
169 0.36
170 0.33
171 0.37
172 0.45
173 0.5
174 0.57
175 0.65
176 0.72
177 0.79
178 0.88
179 0.9
180 0.9
181 0.89
182 0.89
183 0.88
184 0.87