Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0H3Z3

Protein Details
Accession A0A0L0H3Z3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-42MSSAPKPDSLKKKPTKPSSAKKAEDHHydrophilic
NLS Segment(s)
PositionSequence
27-34KKKPTKPS
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024145  His_deAcase_SAP30/SAP30L  
IPR038291  SAP30_C_sf  
IPR025718  SAP30_Sin3-bd  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF13867  SAP30_Sin3_bdg  
Amino Acid Sequences MSTKVKTIGNGSHHSLMSSAPKPDSLKKKPTKPSSAKKAEDHVSQVDFSTMDDRVLRRYKRTFKLRAKSSKESRDELVSSVTKHFLQQEINEKDTITFFIYTLRNQENVYKLPPKVPVVSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.27
4 0.28
5 0.26
6 0.24
7 0.2
8 0.24
9 0.27
10 0.35
11 0.44
12 0.45
13 0.52
14 0.59
15 0.68
16 0.74
17 0.8
18 0.82
19 0.82
20 0.85
21 0.85
22 0.86
23 0.81
24 0.74
25 0.71
26 0.65
27 0.57
28 0.49
29 0.41
30 0.33
31 0.28
32 0.24
33 0.19
34 0.14
35 0.12
36 0.1
37 0.08
38 0.07
39 0.09
40 0.09
41 0.14
42 0.21
43 0.22
44 0.25
45 0.33
46 0.41
47 0.49
48 0.57
49 0.62
50 0.65
51 0.73
52 0.77
53 0.79
54 0.78
55 0.79
56 0.78
57 0.77
58 0.71
59 0.64
60 0.57
61 0.51
62 0.44
63 0.35
64 0.31
65 0.24
66 0.21
67 0.19
68 0.2
69 0.16
70 0.16
71 0.17
72 0.15
73 0.16
74 0.19
75 0.28
76 0.31
77 0.33
78 0.32
79 0.3
80 0.29
81 0.27
82 0.24
83 0.16
84 0.12
85 0.1
86 0.16
87 0.17
88 0.18
89 0.23
90 0.24
91 0.23
92 0.24
93 0.29
94 0.29
95 0.31
96 0.36
97 0.36
98 0.35
99 0.38
100 0.42
101 0.41