Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0HBH7

Protein Details
Accession A0A0L0HBH7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-130GLAESQKTARKQRKERKNRSKKFRGTKKAKAAKAAKBasic
NLS Segment(s)
PositionSequence
100-130QKTARKQRKERKNRSKKFRGTKKAKAAKAAK
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSVTIRTRKFLTNPLLQRKQMVVDVLHPGRANVSKKELREKLAKLYKTDEESIFVFGFRTQFGGGKSTGFALIYNSLDSAKKFEPKYRLVRHGLAESQKTARKQRKERKNRSKKFRGTKKAKAAKAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.55
3 0.62
4 0.67
5 0.62
6 0.61
7 0.54
8 0.5
9 0.42
10 0.35
11 0.26
12 0.21
13 0.29
14 0.26
15 0.27
16 0.24
17 0.22
18 0.22
19 0.27
20 0.27
21 0.22
22 0.3
23 0.32
24 0.34
25 0.44
26 0.45
27 0.44
28 0.47
29 0.47
30 0.49
31 0.52
32 0.52
33 0.44
34 0.45
35 0.44
36 0.4
37 0.41
38 0.31
39 0.25
40 0.23
41 0.23
42 0.19
43 0.15
44 0.12
45 0.1
46 0.1
47 0.08
48 0.08
49 0.06
50 0.08
51 0.08
52 0.1
53 0.1
54 0.09
55 0.1
56 0.09
57 0.09
58 0.07
59 0.07
60 0.06
61 0.08
62 0.08
63 0.08
64 0.07
65 0.08
66 0.09
67 0.09
68 0.12
69 0.13
70 0.18
71 0.2
72 0.25
73 0.31
74 0.38
75 0.48
76 0.51
77 0.56
78 0.55
79 0.57
80 0.54
81 0.52
82 0.49
83 0.44
84 0.39
85 0.34
86 0.34
87 0.35
88 0.37
89 0.44
90 0.48
91 0.54
92 0.63
93 0.71
94 0.77
95 0.84
96 0.91
97 0.92
98 0.95
99 0.95
100 0.95
101 0.95
102 0.95
103 0.94
104 0.94
105 0.94
106 0.92
107 0.92
108 0.92
109 0.91
110 0.85