Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0HNQ0

Protein Details
Accession A0A0L0HNQ0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
81-105PRPKEAPKRVEKKVEKPEPSKKEDKBasic
NLS Segment(s)
PositionSequence
82-102RPKEAPKRVEKKVEKPEPSKK
Subcellular Location(s) mito 13, cyto_nucl 10, cyto 8.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008606  EIF4EBP  
Gene Ontology GO:0008190  F:eukaryotic initiation factor 4E binding  
GO:0045947  P:negative regulation of translational initiation  
Pfam View protein in Pfam  
PF05456  eIF_4EBP  
Amino Acid Sequences MSSKHFLTPSPSAPVAVRRAGPGEKPPHDFGTTPGGTIFGTTPGGTRIIYTKDALLNLSRSPLAQTPPKGLAYIPGVTNVPRPKEAPKRVEKKVEKPEPSKKEDKDDLFDMEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.31
4 0.28
5 0.23
6 0.27
7 0.27
8 0.29
9 0.31
10 0.36
11 0.37
12 0.41
13 0.43
14 0.43
15 0.43
16 0.4
17 0.34
18 0.34
19 0.3
20 0.25
21 0.21
22 0.18
23 0.16
24 0.17
25 0.15
26 0.07
27 0.07
28 0.07
29 0.07
30 0.08
31 0.09
32 0.08
33 0.08
34 0.09
35 0.11
36 0.12
37 0.12
38 0.13
39 0.13
40 0.13
41 0.13
42 0.12
43 0.11
44 0.1
45 0.1
46 0.09
47 0.08
48 0.09
49 0.1
50 0.13
51 0.16
52 0.17
53 0.19
54 0.22
55 0.23
56 0.21
57 0.19
58 0.19
59 0.18
60 0.18
61 0.15
62 0.14
63 0.14
64 0.14
65 0.2
66 0.21
67 0.21
68 0.21
69 0.23
70 0.3
71 0.41
72 0.49
73 0.52
74 0.59
75 0.64
76 0.7
77 0.79
78 0.78
79 0.77
80 0.8
81 0.8
82 0.79
83 0.79
84 0.83
85 0.8
86 0.8
87 0.8
88 0.73
89 0.72
90 0.72
91 0.69
92 0.64
93 0.6