Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FVG7

Protein Details
Accession Q6FVG7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
139-159MSKGRKFESARGRRRSKGFKVBasic
NLS Segment(s)
PositionSequence
123-159VRHFGMGPHKNKAPRIMSKGRKFESARGRRRSKGFKV
Subcellular Location(s) mito 20, cyto 5.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR021132  Ribosomal_L18/L18-A/B/e_CS  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cgr:CAGL0E02013g  -  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
PROSITE View protein in PROSITE  
PS01106  RIBOSOMAL_L18E  
Amino Acid Sequences MLVRLYTFLARRTDAPFNKVVLKSLFLSKINRPPVSISRIARALKQEGAASKTVVVVGTVTDDARLFDLPKTTVAALRFTAGARARIVKAGGECITLDQLAVRAPKGQNTLILRGPRNAREAVRHFGMGPHKNKAPRIMSKGRKFESARGRRRSKGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.4
4 0.39
5 0.44
6 0.42
7 0.4
8 0.32
9 0.31
10 0.28
11 0.3
12 0.32
13 0.28
14 0.32
15 0.35
16 0.42
17 0.47
18 0.45
19 0.41
20 0.42
21 0.45
22 0.47
23 0.48
24 0.41
25 0.37
26 0.42
27 0.42
28 0.39
29 0.37
30 0.34
31 0.28
32 0.28
33 0.26
34 0.22
35 0.24
36 0.22
37 0.19
38 0.16
39 0.14
40 0.13
41 0.11
42 0.08
43 0.06
44 0.05
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.07
53 0.07
54 0.07
55 0.09
56 0.09
57 0.09
58 0.1
59 0.1
60 0.12
61 0.12
62 0.13
63 0.11
64 0.11
65 0.11
66 0.1
67 0.14
68 0.12
69 0.13
70 0.12
71 0.13
72 0.13
73 0.14
74 0.14
75 0.11
76 0.11
77 0.12
78 0.12
79 0.1
80 0.1
81 0.09
82 0.1
83 0.08
84 0.08
85 0.05
86 0.05
87 0.07
88 0.07
89 0.07
90 0.11
91 0.12
92 0.15
93 0.18
94 0.19
95 0.22
96 0.25
97 0.28
98 0.28
99 0.33
100 0.31
101 0.33
102 0.37
103 0.34
104 0.35
105 0.34
106 0.31
107 0.35
108 0.38
109 0.38
110 0.36
111 0.34
112 0.31
113 0.33
114 0.4
115 0.39
116 0.39
117 0.39
118 0.42
119 0.46
120 0.49
121 0.53
122 0.52
123 0.53
124 0.58
125 0.63
126 0.68
127 0.73
128 0.79
129 0.73
130 0.74
131 0.69
132 0.69
133 0.7
134 0.7
135 0.71
136 0.71
137 0.76
138 0.75
139 0.82